(data stored in SCRATCH zone)

EMBL: AP010958.PE528

AP010958.PE528       Location/Qualifiers
FT   CDS_pept        complement(584387..585484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0528"
FT                   /product="putative outer membrane porin protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29395"
FT                   /db_xref="GOA:C8U2N7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N7"
FT                   /protein_id="BAI29395.1"
FT                   /translation="MKKLTVAISAVAASVLMAMSAQAAEIYNKDSNKLDLYGKVNAKHY
FT                   FSSNDADDGDTTYVRLGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAG
FT                   LKFGDYGSIDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNNDFF
FT                   GLVDGLNFAAQYQGKNDRSDFDNYTEGNGDGFGFSATYEYEGFGIGATYAKSDRTDTQV
FT                   NAGKVLPEVFASGKNAEVWAAGLKYDANNIYLATTYSETQNMTVFADHFVANKAQNFEA
FT                   VAQYQFDFGLRPSVAYLQSKGKDLGVWGDQDLVKYVDVGATYYFNKNMSTFVDYKINLL
FT                   DKNDFTKALGVSTDDIVAVGLVYQF"
     atgaaaaaat taacagtggc aatttctgct gtagctgcat cagtactgat ggcgatgtct        60
     gctcaggcag ctgaaattta taataaagac agtaacaagc tggatctgta cgggaaagtt       120
     aatgccaagc actacttttc ctctaacgat gcagatgatg gtgatactac ttatgttcgt       180
     ctgggcttca aaggcgaaac ccaaatcaac gatcagctga ctggtttcgg tcagtgggaa       240
     tatgaattca aaggcaaccg cgctgaatct caaggttcct ccaaagacaa aacccgtctt       300
     gcatttgcag gcctgaaatt cggtgactac ggctcaatcg attacggccg taactacggt       360
     gtagcatacg acatcggtgc gtggactgac gttctgccag aattcggtgg cgatacctgg       420
     acccaaacag atgtgttcat gactggtcgc accactggtg ttgcaaccta tcgtaacaac       480
     gacttctttg gtctggttga tggtctgaac tttgctgctc agtaccaagg caaaaacgat       540
     cgtagcgatt tcgataacta caccgaaggt aacggtgatg gcttcggttt ctctgctacc       600
     tatgaatacg aaggattcgg tatcggtgca acttatgcga aatctgatcg taccgacact       660
     caagttaatg cagggaaagt tcttcctgaa gtatttgctt ccggtaaaaa tgcagaagtt       720
     tgggccgcag gtctgaaata tgacgctaac aacatttacc tggccactac ctattctgaa       780
     acccagaata tgactgtatt tgctgatcac ttcgttgcta ataaagctca aaacttcgaa       840
     gctgttgcac aatatcagtt cgatttcggt ctgcgtccgt ccgttgctta cctgcaatct       900
     aaaggtaagg atcttggagt atggggcgat caggacttag tcaaatatgt tgatgtaggt       960
     gcaacctatt acttcaacaa aaatatgtct actttcgttg attacaaaat caacctgctt      1020
     gacaaaaatg acttcactaa agcactcggt gtaagcactg atgacatcgt tgctgtaggt      1080
     ctggtttacc agttctaa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page