(data stored in SCRATCH zone)

EMBL: AP010958.PE529

AP010958.PE529       Location/Qualifiers
FT   CDS_pept        586073..586288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0529"
FT                   /product="putative holin protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29396"
FT                   /db_xref="GOA:C8U2N8"
FT                   /db_xref="InterPro:IPR007054"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N8"
FT                   /protein_id="BAI29396.1"
FT                   /translation="MKFMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSL
FT                   VFGLLTYLTNLYFKIKEDKRKAARGE"
     atgaaattca tggataagtt aacaactgga gtcgcctatg gcacctcagc aggtagtgcc        60
     ggttactggt ttttacagct gctcgataaa gtcactccct cacagtgggc agcaataggt       120
     gtgctgggta gcctggtatt tggcctgctg acgtacctga caaaccttta tttcaagatt       180
     aaagaagata agcgcaaggc tgcgagaggt gaataa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page