(data stored in SCRATCH zone)

EMBL: AP010958.PE530

AP010958.PE530       Location/Qualifiers
FT   CDS_pept        586288..586785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0530"
FT                   /product="putative endolysin protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29397"
FT                   /db_xref="GOA:C8U2N9"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N9"
FT                   /protein_id="BAI29397.1"
FT                   /translation="MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDI
FT                   VGVWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYS
FT                   FVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWG
FT                   QQ"
     atgcctccat cattacgaaa agccgttgct gctgctattg gtggcggagc aattgctata        60
     gcatcagtgt taatcactgg cccaagtggt aacgatggtc tggaaggtgt cagctacata       120
     ccatacaaag atattgttgg tgtatggact gtatgtcacg gacacaccgg aaaagacatc       180
     atgctcggta aaacgtatac caaagcagaa tgcaaagcac tcttgaataa agaccttgcc       240
     actgtcgcca gacaaattaa cccgtatatc aaagttgata taccggaaac aacgcgcggc       300
     gctctttact cattcgttta caatgtgggt gctggcaatt ttagaacatc gacgcttctt       360
     cgcaaaataa accagggcga tatcaaaggc gcatgtgatc agctgcgtcg ctggacatac       420
     gctggcggta agcaatggaa aggcctgatg actcgtcgtg agattgagcg tgaagtctgt       480
     ttgtgggggc aacagtga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page