(data stored in ACNUC10821 zone)

EMBL: AP010958.PE537

AP010958.PE537       Location/Qualifiers
FT   CDS_pept        589509..590054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0537"
FT                   /product="terminase small subunit"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29404"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010906"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2P6"
FT                   /protein_id="BAI29404.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIKWYAERDAEIENEKLRREVEELRQASEADLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGLPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
     atggaagtca acaaaaagca gctggctgac attttcggtg cgagtatccg taccattcag        60
     aactggcagg aacagggaat gcccgttctg cgaggcggtg gcaagggtaa tgaggtgctt       120
     tatgactctg ccgccgtcat aaaatggtat gccgaaaggg atgctgaaat tgagaacgaa       180
     aagctgcgcc gggaggttga agaactgcgg caggccagcg aggcagatct ccagccagga       240
     actattgagt acgaacgcca tcgacttacg cgtgcgcagg ccgacgcaca ggaactgaag       300
     aatgccagag actccgctga agtggtggaa accgcattct gtactttcgt gttgtcgcgg       360
     atcgcaggtg aaattgccag tattctcgac gggctccccc tgtcggtgca gcggcgtttt       420
     ccggaactgg aaaaccgaca tgttgatttc ctgaaacggg atatcatcaa agccatgaac       480
     aaagcagccg cgctggatga actgataccg gggttgctga gtgaatatat cgaacagtca       540
     ggttaa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page