(data stored in ACNUC10821 zone)

EMBL: AP010958.PE539

AP010958.PE539       Location/Qualifiers
FT   CDS_pept        591951..592157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0539"
FT                   /product="putative head-tail joining protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29406"
FT                   /db_xref="GOA:C8U2P8"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="InterPro:IPR036626"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2P8"
FT                   /protein_id="BAI29406.1"
FT                   /translation="MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKK
FT                   YIAELEVQTGMTQRRRGPAGFYV"
     atgacgcgac aggaagaact tgccgctgcc cgtgcggcac tgcatgacct gatgacaggt        60
     aaacgggtgg caacagtaca gaaagacgga cgaagggtgg agtttacggc cacttccgtg       120
     tctgacctga aaaaatatat tgcagagctg gaagtgcaga ccggcatgac acagcgacgc       180
     aggggacctg caggatttta tgtatga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page