(data stored in ACNUC10821 zone)

EMBL: AP010958.PE541

AP010958.PE541       Location/Qualifiers
FT   CDS_pept        593736..595055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0541"
FT                   /product="putative head protein/prohead protease"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29408"
FT                   /db_xref="GOA:C8U2Q0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Q0"
FT                   /protein_id="BAI29408.1"
FT                   /translation="MTAELRNLPHIASMAFNEPLMLEPAYARVFFCALAGQLGISRLTD
FT                   AVSGDSLTAQEALATLALSGDDDGPRQARSYQVMNGIAVLPVSGTLVSRTRALQPYSGM
FT                   TGYNGIIARLQQAASDPMVDGILLDMDTPGGMVAGAFDCADIIARVRDIKPVWALANDM
FT                   NCSAGQLLASAASRRLVTQTARTGSIGVMMAHSNYGAALEKQGVEITLIYSGSHKVDGN
FT                   PYSHLPDDVRETLQSRMDATRRMFAQKVSAYTGLSVQAVLDTEAAVYSGQEAIDAGLAD
FT                   ELVNSTDAITVMRDALDARKSRLSGGRMTKETQSTTVSATASQADVTDVVPATEGENAS
FT                   AAQPDVNAQITAAVAAENSRIMGILNCEEAHGREEQARVLAETPGMTVKTARRILAAAP
FT                   QSAQARSDTALDRLMQGAPAPLAAGNPASDAVNDLLNTPV"
     gtgacagcag agctgcgtaa tctcccgcat attgccagca tggcctttaa tgagccgctg        60
     atgcttgaac ccgcctatgc gcgggttttc ttttgtgcgc ttgcaggcca gcttgggatc       120
     agccgcctga cggatgcggt gtccggcgac agcctgactg cccaggaggc actcgcgacg       180
     ctggcattat ccggtgatga tgacggacca cgacaggccc gcagttatca ggtcatgaac       240
     ggcatcgccg tgctgccggt gtccggcacg ctggtcagcc ggacgcgggc gctgcagccg       300
     tactcgggga tgaccggtta caacggcatt atcgcccgtc tgcaacaggc tgccagcgat       360
     ccgatggtgg acggcattct gctcgatatg gacacgcccg gcgggatggt ggcgggggca       420
     tttgactgcg ctgacatcat cgcccgtgtg cgtgacataa aaccggtatg ggcgcttgcc       480
     aacgacatga actgcagtgc aggtcagttg cttgccagtg ccgcctcccg gcgtctggtc       540
     acgcagaccg cccggacagg ctccatcggc gtcatgatgg ctcacagtaa ttacggtgct       600
     gcgctggaga aacagggtgt ggaaatcacg ctgatttaca gcggcagcca taaggtggat       660
     ggcaacccct acagccatct tccggatgac gtccgggaga cactgcagtc ccggatggac       720
     gcaacccgcc ggatgtttgc gcagaaggtg tcggcatata ccggcctgtc cgtgcaggct       780
     gtgctggata ccgaggctgc agtgtacagc ggtcaggagg ccattgatgc cggactggct       840
     gatgaacttg ttaacagcac cgatgcgatc accgtcatgc gtgatgcact ggatgcacgt       900
     aaatcccgtc tctcaggagg gcgaatgacc aaagagactc aatcaacaac tgtttcagcc       960
     actgcttcgc aggctgacgt tactgacgtg gtgccagcga cggagggcga gaacgccagc      1020
     gcggcgcagc cggacgtgaa cgcgcagatc accgcagcgg ttgcggcaga aaacagccgc      1080
     attatgggga tcctcaactg tgaggaggct cacggacgcg aagaacaggc acgcgtgctg      1140
     gcagaaaccc ccggtatgac cgtgaaaacg gcccgccgca ttctggccgc agcaccacag      1200
     agtgcacagg cgcgcagtga cactgcgctg gatcgtctga tgcagggggc accggcaccg      1260
     ctggctgcag gtaacccggc atctgatgcc gttaacgatt tgctgaacac accagtgtaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page