(data stored in ACNUC10821 zone)

EMBL: AP010958.PE547

AP010958.PE547       Location/Qualifiers
FT   CDS_pept        597870..598265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0547"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29414"
FT                   /db_xref="InterPro:IPR009312"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="InterPro:IPR038512"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Q6"
FT                   /protein_id="BAI29414.1"
FT                   /translation="MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTG
FT                   AEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVA
FT                   SGYDYRRDDDAGLWSSADLTYVITYEM"
     atgaaacata ctgaactccg tgcagccgta ctggatgcac tggagaagca tgacaccggg        60
     gcgacgtttt ttgatggtcg ccccgctgtt tttgatgagg cggattttcc ggcagttgcc       120
     gtttatctca ccggcgctga atacacgggc gaagagctgg acagcgatac ctggcaggcg       180
     gagctgcata tcgaagtttt cctgcctgct caggtgccgg attcagagct ggatgcgtgg       240
     atggagtccc ggatttatcc ggtgatgagc gatatcccgg cactgtcaga tttgatcacc       300
     agtatggtgg ccagtggcta tgactaccgg cgcgacgatg atgcgggcct gtggagttca       360
     gccgatctga cttatgtcat tacctatgaa atgtga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page