(data stored in ACNUC10821 zone)

EMBL: AP010958.PE548

AP010958.PE548       Location/Qualifiers
FT   CDS_pept        598294..599013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0548"
FT                   /product="putative major tail protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29415"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR032494"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Q7"
FT                   /protein_id="BAI29415.1"
FT                   /translation="MPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTA
FT                   ESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIR
FT                   FPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTAATGMTVTPSS
FT                   TSVVKGQSTTLTVAFQPEGVTDKSFRAVSADKTKATVSVSGMTITVNGVAAGKVNIPVV
FT                   SGNGEFAAVAEITVTAS"
     atgccggtga aaggtgccgg gaccaccctg tgggtttata aggggagcgg tgacccttat        60
     gcgaatccgc tttcagacgt tgactggtcg cgtctggcaa aagttaaaga cctgacgccc       120
     ggcgaactga ccgctgagtc ctatgacgac agctatctcg atgatgaaga tgcagactgg       180
     actgcgaccg ggcaggggca gaaatctgcc ggagatacca gcttcacgct ggcgtggatg       240
     cccggagagc aggggcagca ggcgctgctg gcgtggttta atgaaggcga tacccgtgcc       300
     tataaaatcc gcttcccgaa cggcacggtc gatgtgttcc gtggctgggt cagcagtatc       360
     ggtaaggcgg tgacggcgaa ggaagtgatc acccgcacgg tgaaagtcac caatgtggga       420
     cgtccgtcga tggcagaaga tcgcagcacg gtaacagcgg caaccggcat gaccgtgacg       480
     ccttccagca cctcggtggt gaaagggcag agcaccacgc tgaccgtggc cttccagccg       540
     gagggcgtaa ccgacaagag ctttcgtgcg gtgtctgcgg ataaaacaaa agccaccgtg       600
     tcggtcagtg gtatgaccat caccgtgaac ggcgttgctg caggcaaggt caacattccg       660
     gttgtatccg gtaatggtga gtttgctgcg gttgcagaaa ttaccgtcac cgccagttaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page