(data stored in ACNUC10821 zone)

EMBL: AP010958.PE553

AP010958.PE553       Location/Qualifiers
FT   CDS_pept        602337..602666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0553"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29418"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R0"
FT                   /protein_id="BAI29418.1"
FT                   /translation="MKTFRWKVKPGMDVASVPSVRKVRFGDGYSQRAPAGLNANLKTYS
FT                   VTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEF
FT                   EQVVN"
     atgaagacct tccgctggaa agtgaaaccc ggtatggatg tggcttcggt cccttctgta        60
     agaaaggtgc gctttggtga tggctattct cagcgagcgc ctgccgggct gaatgccaac       120
     ctgaaaacgt acagcgtgac gctttctgtc ccccgtgagg aggccacggt actggagtcg       180
     tttctggaag agcacggggg ctggaaatcc tttctgtgga cgccgcctta tgagtggcgg       240
     cagataaagg tgacctgcgc aaaatggtcg tcgcgggtca gtatgctgcg tgttgagttc       300
     agcgcagagt ttgaacaggt ggtgaactga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page