(data stored in ACNUC10821 zone)

EMBL: AP010958.PE554

AP010958.PE554       Location/Qualifiers
FT   CDS_pept        602666..603364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0554"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29419"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R1"
FT                   /protein_id="BAI29419.1"
FT                   /translation="MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEK
FT                   GEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVV
FT                   RRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVF
FT                   PGRIMLANTCTWTYRGDECGYHGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFG
FT                   GFLSINKLSQ"
     atgcaggata tccggcagga aacactgaat gaatgcaccc gtgcggagca gtcggccagc        60
     gtggtgctct gggaaatcga cctgacagag gtcggtggag aacgttattt tttctgtaat       120
     gagcagaacg aaaaaggtga gccggtcacc tggcaggggc gacagtatca gccgtatccc       180
     attcagggga gcggttttga actgaatggc aaaggcacca gtacgcgccc cacgctgacg       240
     gtttctaacc tgtacggtat ggtcaccggg atggcggaag atatgcagag tctggtcggc       300
     ggaacggtgg tccggcgtaa ggtttacgcc cgttttctgg atgcggtgaa cttcgtcaac       360
     ggaaacagtt acgccgatcc ggagcaggag gtgatcagcc gctggcgcat cgagcagtgc       420
     agcgaactga gcgcggtgag tgcctctttt gtactgtcca cgccgacgga aacggacggt       480
     gccgtttttc cggggcgcat catgctggcc aacacctgca cctggaccta tcgcggtgac       540
     gagtgcggtt atcacggtcc ggcggtcgcg gatgaatatg atcagccgac gtccgatatc       600
     acgaaggata aatgcagcaa atgcctgagc ggctgtaagt ttcgcaataa cgtcggcaac       660
     tttggcggct tcctttccat taacaaactt tcgcagtga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page