(data stored in SCRATCH zone)

EMBL: AP010958.PE557

AP010958.PE557       Location/Qualifiers
FT   CDS_pept        604719..608117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0557"
FT                   /product="putative host specificity protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29422"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR021034"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R4"
FT                   /protein_id="BAI29422.1"
FT                   /translation="MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPVEGPVDGLKSV
FT                   LLNSTPVLDSEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRAI
FT                   TSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQY
FT                   LASVVVDNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQGYPNTALVGVKV
FT                   DSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTLKPAYSNNPAWCLWDMLT
FT                   HPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLS
FT                   DFCSAMRCMPVWNGQTLTFVQDRPSDKVWTYNRSNVVMPDDGAPFRYSFSALKDRHNAV
FT                   EVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLE
FT                   TQTVDFSVGAEGLRHVPGDVIEICDDDYAGISIGGRVLAVNSQTRTLTLDREITLPSSG
FT                   TTLISLVDGQGNPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWGLKLPTLRQRLFRCVSI
FT                   RENDDGTYAITAVQHVPEKEAIVDNGAHFDGDQSGTVNGVTPPAVQHLTAEVTADSGEY
FT                   QVLARWDTPKVVKGVSFMLRLTVAADDGSERLVSTARTTETTYRFTQLALGNYRLTVRA
FT                   ANAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKRI
FT                   TDIRQVETTARYLGTGLYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGRASDDAE
FT                   GYLDFFKGKITESHLGKELLEKVDLTEDNASRLDEFSKEWKDANDKWNAMWGVKIEQTK
FT                   DGKHYVAGIGLSMEDTEEGKLSQFLVAANRIAFIDPANGNETPMFVAQGNQIFMNDVFL
FT                   KRLTAPTITSGGSPPVFSLTSDGKLTAKNADISGSVNANSGTLNNVTINENCQIKGKLS
FT                   ANQIEGDIVKTVSKSFPRTSTYASGTITVRISDDQKFDRQVMIPPVLFRGGKHENFNSN
FT                   NQQSYWYSTCRLRVTRNGQEIFNQSTTDAQGVFSSVIDMPAGQGTLTLTFTVSSSGANN
FT                   WTPTTSISDLLVVVMKKSTAGISIS"
     atgggtaaag gcagcagtaa ggggcatacc ccgcgcgaag cgaaggacaa cctgaagtcc        60
     acgcagctgc tgagtgtgat cgatgccatc agcgaagggc cggttgaagg tccggtggat       120
     ggattaaaaa gcgtgctgct gaacagtacg ccggtgctgg acagtgaggg gaataccaat       180
     atatccggcg tcacggtggt gttccgggcc ggtgagcagg agcagacacc gccggaggga       240
     tttgaatcct ccggctccga gacggtgctc ggtacagaag tgaaatatga cacgccgatc       300
     acccgcgcca tcacgtcggc aaacatcgac cgactgcgct ttaccttcgg tgtgcaggca       360
     ctggtggaaa ccacctcaaa gggggaccgg aatccgtcgg aagttcgcct gctggttcag       420
     atacagcgta atggtggctg ggtgacggaa aaagacatca ccattaaggg caaaaccacc       480
     tcgcagtatc tggcctcggt ggtggtggat aacctgccgc cgcgcccgtt taatatccgg       540
     atgcgcagaa tgacgccgga cagcaccaca gaccagctgc agaacaaaac gctctggtcg       600
     tcatacaccg aaatcatcga tgtgaaacag ggctacccga acacggcact ggtcggcgta       660
     aaggtggatt cggagcagtt cggcagccag caggtgagcc gtaattatca tcttcgcggg       720
     cgtattctgc aggtgccgtc gaactataac ccgcagacgc ggcaatacag cggtatctgg       780
     gacggaacgt taaaaccggc atacagcaac aacccggcct ggtgtctgtg ggatatgctg       840
     acccacccgc gctacggcat ggggaaacgt cttggtgcgg cggatgtgga taaatgggcg       900
     ctgtatgtca tcggccagta ctgcgaccag tcggtgccgg acggctttgg cggcacggag       960
     ccgcgcatta cctgtaatgc gtacctgacc acacagcgta aggcgtggga tgtgctcagt      1020
     gatttctgct cggcgatgcg ctgtatgccg gtatggaacg ggcagacgct gacgttcgtg      1080
     caggaccgac catcagataa ggtgtggacc tataaccgca gtaatgtggt gatgccggat      1140
     gatggtgcgc cgttccgcta cagcttcagc gccctgaagg accgccataa tgccgttgag      1200
     gtgaactgga ttgacccgaa taacggctgg gagacggcga cagagcttgt tgaagatacg      1260
     caggccattg cccgttacgg tcgtaatgtc acgaagatgg atgcctttgg ttgtaccagt      1320
     cgggggcagg cacaccgagc cgggctgtgg ctgattaaaa cggaactgct ggaaacgcag      1380
     accgtggatt tcagcgtggg cgcagaaggg cttcgccatg tgccgggcga tgttattgaa      1440
     atctgcgatg atgactatgc cggtatcagc atcggtggtc gcgtgctggc ggtgaacagc      1500
     cagacccgga cgctgacgct cgaccgtgaa atcacgctgc catcctccgg caccacgctg      1560
     ataagcctgg ttgacgggca gggtaatccg gtcagcgtgg aggtccagtc cgtcaccgac      1620
     ggcgtgaagg tgaaagtgag ccgtgttcct gacggcgttg ctgaatacag cgtatggggg      1680
     ctgaagttgc cgacgttgcg ccagcgcctg ttccgctgcg tgagtatccg tgagaacgac      1740
     gacggcacgt atgccatcac cgccgtgcag catgtacccg aaaaagaagc catcgtggat      1800
     aacggggcgc actttgacgg cgaccagagc ggcacggtga atggcgtcac gccgcccgcg      1860
     gtgcagcacc tgactgccga agtcaccgca gacagcgggg aatatcaggt gctggcgcgc      1920
     tgggacacgc cgaaggtggt gaagggcgtg agctttatgc ttcgcctgac cgtggcagcg      1980
     gatgacggca gtgagcggct ggtcagcacg gcccggacga cggaaaccac ataccgcttc      2040
     acgcaactgg cgctggggaa ctacaggctg acagtccggg cggcaaatgc ctgggggcag      2100
     cagggcgatc cggcgtcggt atcgttccgg attgccgcac cggcagcacc gtcgcggatt      2160
     gagctgacgc cgggctattt tcagataacc gcaacgccgc atcttgccgt ttatgatccg      2220
     acggtacagt ttgagttctg gttctcggaa aagcggatta ccgatatcag gcaggttgaa      2280
     accacagccc gctaccttgg cacggggctg tactggatag ccgccagtat caatatcaaa      2340
     ccgggccatg attattactt ttatatccgc agtgtgaaca ccgttggcaa atcggcattc      2400
     gtggaggccg tcggtcgggc gagcgatgat gcggaaggtt acctggattt tttcaaaggc      2460
     aagataaccg aatcccatct cggtaaagag ctgctggaaa aagttgatct gacggaggat      2520
     aacgccagca gactggatga gttttcgaaa gagtggaagg acgctaacga taaatggaat      2580
     gccatgtggg gcgtcaaaat tgagcagacc aaagacggca aacattatgt cgcgggtatt      2640
     ggtctcagca tggaggacac ggaggaaggc aagctgagcc agtttctggt tgccgctaac      2700
     cgtatcgcgt ttattgaccc ggcaaacggg aatgaaacgc cgatgtttgt ggcgcagggc      2760
     aaccagatat tcatgaacga cgtgttcctg aagcgcctga cagcccccac cattaccagc      2820
     ggtggcagcc ctccggtatt ttccctgaca tcagacggaa agctgaccgc taaaaatgcg      2880
     gatatcagtg gcagtgtgaa tgcgaactca gggacgctca acaacgtcac gattaatgag      2940
     aactgtcaga ttaaggggaa actgtcagcc aaccagattg aaggtgatat tgtcaaaacg      3000
     gtcagcaagt ctttcccccg cacgagcact tatgccagtg gcaccatcac ggtaagaatc      3060
     agtgatgatc agaaatttga ccggcaggtc atgataccgc cagtgttatt ccgcggtggt      3120
     aagcatgaga atttcaacag taataaccaa cagtcatact ggtattcaac ctgccggtta      3180
     agagtgaccc gcaatggtca ggagattttt aatcagtcca cgacggatgc tcagggcgta      3240
     ttttcctcag ttatagatat gcctgccgga caggggacgc tgacactgac attcaccgta      3300
     tcttcatcag gagcgaataa ctggacacca acaaccagta tcagcgatct gctggttgtg      3360
     gtgatgaaaa aatccacagc aggtatcagt atcagctga                             3399
//

If you have problems or comments...

PBIL Back to PBIL home page