(data stored in ACNUC10821 zone)

EMBL: AP010958.PE559

AP010958.PE559       Location/Qualifiers
FT   CDS_pept        608848..611763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0559"
FT                   /product="putative side tail fiber protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29424"
FT                   /db_xref="GOA:C8U2R6"
FT                   /db_xref="InterPro:IPR005003"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR013609"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R6"
FT                   /protein_id="BAI29424.1"
FT                   /translation="MAVKISGVLKDGTGKPVQNCTIQLKAKRNSTTVVVNTLASENPDE
FT                   AGRYSMDVEYGQYSVILLVEGFPPSHAGTITVYEDSQPGTLNDFLGAMTEDDARPEALR
FT                   RFEQMVEEVARNASVVAQNTAAAKKSASDAGTSAREAATHATDAADSARAASTSAGQAA
FT                   SSAQSASSSAGTASTKATEAEKSAAAAESSKSAAATSAAAAKTSETNAAASQQSAATSA
FT                   STATTKASEAATSARDASASKEAAKSSETNASSSASSAASSATAAANSAKAAKTSETNA
FT                   RSSETAAGQSASAAAGSKTAAASSASAASTSAGQASASATAAGKSAESAASSASTATTK
FT                   AGEATEQASAAARSASAAKTSETNAKASETSAESSKTAAASSASSAASSASSASASKDE
FT                   ATRQASAAKGSATTASTKATEAAGSATAAAQSKSTAESAATRAETAAKRAEDIASAVAL
FT                   EDASTTKKGIVQLSSATNSTSESLAATPKAVKAAYELANGKYTAQDATTAQKGIVQLSS
FT                   ATNSTSEMLAATPKSVKAAYDLANGKYTAQDATTAQKGIVQLSSATNSASETLAATPKA
FT                   VKAANDNANGRVPSARKVNGKALSADITLTPKDIGTLNSTTMSFSGGAGWFKLATVTMP
FT                   QASSVVSITLIGGAGFNVGSPQQAGISELVLRAGNGNPKGITGALWQRTSTGFTNFAWV
FT                   NTSGDTYDIYVAIGNYATGVNIQWDYTSNASVTIHTSPAYSANKPEGLTDGTVYSLYTP
FT                   SEQFYPPGAPIPWPSDTVPSGYALMQGQTFDKSAYPKLATAYPSGVIPDMRGWTIKGKP
FT                   ASGRAVLSQEQDGIKSHTHSASASSTDLGTKTTSSFDYGTKSTNNTGAHTHSVSGTAAS
FT                   AGNHTHSVTGASAVSQWSQNGSVHKVVSAASVNTSAAGAHTHSVSGTVASAGAHAHTVG
FT                   IGAHTHSVAIGSHGHTITVNAAGNAENTVKNIAFNYIVRLA"
     atggcagtaa agatttcagg tgtactgaaa gacggcacag gaaaaccggt acagaactgc        60
     acaatccagc tgaaagcaaa acgtaacagc accacggtgg tggtgaacac gctggcctca       120
     gaaaatccgg atgaagccgg gcgttacagc atggacgttg agtacgggca gtacagcgtt       180
     attctgttgg tggaaggatt cccgccgtca catgccggga ccatcaccgt gtatgaagat       240
     tctcaacccg gtacgctgaa tgattttctc ggtgccatga cggaggatga tgcccgtccg       300
     gaggcactgc gccgttttga acagatggtg gaagaggtgg cgcgtaacgc gtccgtggtg       360
     gcacagaaca cggcagccgc gaagaagtca gccagtgatg ccggcacatc tgcccgtgag       420
     gcggcaaccc atgcgactga tgctgcagat tcagcacgtg cagccagcac gtcagccgga       480
     caggccgctt cgtcggctca gtcagcgtct tccagcgcag gaacggcatc aacaaaggcc       540
     actgaagcgg aaaaaagtgc tgccgctgca gagtcctcaa aaagcgcggc agctaccagt       600
     gccgctgccg cgaaaacgtc agaaacgaat gctgcagcgt cacaacaatc agccgccact       660
     tctgcatcca ccgcgaccac gaaagcgtca gaagctgcca cctcagcccg ggatgcgtcg       720
     gcttcaaaag aggcggcaaa atcatcagaa acgaacgcat cctcgagcgc cagtagcgca       780
     gcttcctcgg caacggcggc agcaaattcc gcgaaggcgg caaaaacgtc cgagacgaac       840
     gccaggtctt ctgagacggc agcgggacag agcgcctcag ctgcggcagg ctcaaaaaca       900
     gcggctgcgt cgtctgccag tgccgcgtca acaagtgccg ggcaggcctc agccagtgcc       960
     accgctgccg gaaaatcggc agaaagcgcc gcatcgtccg cttcaacagc cacaacgaag      1020
     gctggcgaag ccactgaaca ggccagcgca gcagcgaggt ctgcttccgc agcgaagaca      1080
     tccgagacga acgcgaaagc gtcggaaacc agcgcagaat cctcaaaaac ggctgccgca      1140
     tcgtccgcca gttcggcggc gtcatcggca tcatctgcgt ctgcttcaaa agatgaggcg      1200
     accagacagg cgtcagcagc aaagggcagc gccacgacgg catccacgaa ggcgacagag      1260
     gcagctggca gtgcgacggc ggcagctcag agcaaaagta cggcggaatc cgcggcaacg      1320
     cgcgccgaga cagcggcaaa acgggcagag gatattgcat ccgccgtggc gcttgaggat      1380
     gcgagcacga cgaaaaaggg gatagtacag ctcagcagtg cgactaacag cacttccgag      1440
     tcactggcgg caacgccaaa agccgttaag gccgcgtatg agctggctaa cgggaaatac      1500
     accgcacagg atgcaacgac agcacagaaa gggatagttc agctcagcag cgcgaccaac      1560
     agcacatctg aaatgctggc ggcaacgcca aagtcggtaa aggcagccta tgaccttgct      1620
     aacgggaaat atactgctca ggacgctacg acagcacaaa aaggaattgt ccagctcagt      1680
     agtgcaacca acagcgcatc tgaaacgctt gccgcgacac cgaaagcagt gaaagcagct      1740
     aatgataatg cgaatggtcg ggtaccttct gcccgtaagg tgaatggtaa ggcgctttca      1800
     gcggatataa cactgacgcc gaaagatatt ggtacgctta actcaacaac aatgtcattc      1860
     agcggtggtg ctggttggtt caaattagca acggtaacca tgccacaggc gagttctgtt      1920
     gtttcaatta cgttgattgg tggcgcggga tttaacgtgg ggtcacctca acaggcaggt      1980
     atatctgaac ttgttttgcg tgcaggtaat ggtaatccga aggggattac tggtgcttta      2040
     tggcagcgca catcgacagg gtttacaaat tttgcctggg tcaatacatc tggtgatact      2100
     tacgatattt acgttgcaat cggaaattat gcgactggtg taaatattca atgggattat      2160
     accagtaatg ccagcgtgac tattcatacg tcaccagcat attctgctaa taagccggaa      2220
     gggttaacgg acggtacagt ttattcactc tatacaccat cagagcagtt ttatccgcct      2280
     ggcgcaccaa tcccgtggcc atcagatacc gttccgtctg gttatgccct gatgcagggg      2340
     cagacttttg acaaatccgc ttacccgaaa cttgcaaccg cttatccgtc aggcgtgatc      2400
     cctgatatgc gtggctggac gattaagggc aaacctgcca gtggtcgggc cgtattgtct      2460
     caggaacagg acggcattaa atcgcacacc cacagcgcca gtgcatccag tacggatttg      2520
     gggacgaaaa ccacatcgtc gtttgattac ggcactaaat ccacgaataa caccggggcg      2580
     catacgcaca gtgtgagcgg tacagccgca agtgccggaa accatactca tagtgtcaca      2640
     ggcgcatcag cagtcagcca gtggtcacaa aatgggtcag tacataaggt agtgtctgcg      2700
     gccagtgtga atacaagtgc tgcaggagcg cacactcata gtgtcagcgg cacagttgca      2760
     tctgcaggtg ctcacgcaca tactgtcggt attggtgctc atacgcactc tgttgcgatt      2820
     ggctcacatg gacacaccat caccgttaac gctgctggta acgcggaaaa cactgtcaaa      2880
     aacatcgcat ttaactacat tgtgaggctt gcataa                                2916
//

If you have problems or comments...

PBIL Back to PBIL home page