(data stored in ACNUC10821 zone)

EMBL: AP010958.PE564

AP010958.PE564       Location/Qualifiers
FT   CDS_pept        614851..615156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0564"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29429"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2S1"
FT                   /protein_id="BAI29429.1"
FT                   /translation="MLPQHSDIEIAWYASIQQELNGWKTVTTQFYIQEFSEYIAPLQDA
FT                   VDLEIATEEERSLLEAWNKYRVLLNRVDTSVALGMKLFVTHVTVTVITISKVQNVY"
     atgctgccgc agcatagcga tattgaaata gcctggtatg cttcgataca gcaggagctg        60
     aatggctgga agaccgtcac cacacagttc tacatccagg aattcagtga gtatattgcg       120
     ccactgcagg atgctgtaga tctggaaatc gcaacggagg aagaaagatc gttgctggag       180
     gcatggaata aatatcgggt attgttgaat cgagttgata catcagtagc tctgggtatg       240
     aagctgtttg taactcatgt tacagtaaca gtcattacta tctcgaaggt gcaaaatgta       300
     tattga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page