(data stored in SCRATCH zone)

EMBL: AP010958.PE571

AP010958.PE571       Location/Qualifiers
FT   CDS_pept        complement(625777..626913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0571"
FT                   /product="putative H repeat-associated protein"
FT                   /note="RhsJ, IS677"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29436"
FT                   /db_xref="GOA:C8U2S8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2S8"
FT                   /protein_id="BAI29436.1"
FT                   /translation="MEFKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAESWE
FT                   DIEDFGETHLDFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSNDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
     atggaattta aaaaattgat ggaacatatt tctattatcc ccgattacag acaagcctgg        60
     aaagtggaac ataaattatc ggatattcta ttgttgacta tttgtgccgt tatttctggt       120
     gcagaaagtt gggaagatat agaggatttc ggggaaacac atctcgattt cttgaagcaa       180
     tatggtgatt ttgaaaatgg tattcctgtt cacgatacta ttgccagagt tgtatcctgt       240
     atcagtcctg caaaatttca tgagtgcttt attaactgga tgcgtgactg ccattcatca       300
     aatgataaag acgtcattgc aattgatgga aaaacgctcc ggcactctta tgacaagagt       360
     cgccgcaggg gagcgattca tgtcattagt gcgttctcaa caatgcacag tctggtcatc       420
     ggacagatca agacggatga gaaatctaat gagattacag ctatcccaga acttcttaac       480
     atgctggata ttaaaggaaa aatcatcaca actgatgcga tgggttgcca gaaagatatt       540
     gcagagaaga tacaaaaaca gggaggtgat tatttattcg cggtaaaagg aaaccagggg       600
     cggctaaata aagcctttga ggaaaaattt ccactgaaag aattaaataa tccagagcat       660
     gacagttacg caatcagtga aaagagtcac ggcagagaag aaatccgtct tcatattgtt       720
     tgcgatgtcc ctgatgaact tattgatttc acgtttgaat ggaaaggtct gaagaaatta       780
     tgcgtggcag tctcctttcg gtcaataata gcagaacaaa agaaagagcc cgaaatgacg       840
     gtcagatatt atatcagttc tgctgattta accgcagaga agttcgccac agcaatccga       900
     aaccactggc acgtggagaa taagctgcac tggcgtctgg acgtggtaat gaatgaagac       960
     gactgcaaaa taagaagagg aaatgcagca gaattatttt cagggatacg gcacatcgct      1020
     attaatattt tgacgaatga taaggtattc aaggcagggt taagacgtaa gatgcgaaaa      1080
     gcagccatgg acagaaacta tctggcgtca gtccttgcgg ggagcgggct ttcgtaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page