(data stored in ACNUC10821 zone)

EMBL: AP010958.PE573

AP010958.PE573       Location/Qualifiers
FT   CDS_pept        complement(628982..629443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0573"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29437"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2S9"
FT                   /protein_id="BAI29437.1"
FT                   /translation="MQFTFNEGHIQLPSQWQDQSMQVLVSTDNSGINLVITREAVPQGT
FT                   LTPELYQETLALYQGKLDGYTEHACREITLAEAPAWLLDYSWNGPEDEGNQGRISQIAV
FT                   FQRRGDTLLTFTFSTSLSLKNSQKTMLLEVIKSFTPLPPENDIQKDQPR"
     atgcagttca cttttaatga aggccacatt caactgccgt ctcaatggca ggatcagtca        60
     atgcaggtcc tggtgtccac agataacagt ggcatcaacc tggtcattac ccgcgaagcc       120
     gttccacagg gaaccctgac accagagctg taccaggaaa cgctggcgct gtaccagggc       180
     aaacttgatg ggtacaccga acatgcctgc cgggaaatca ctctggcaga ggccccggcc       240
     tggctgctgg attattcctg gaacggtccg gaagatgagg ggaatcaggg gcggattagc       300
     cagatagccg tattccagcg gcgtggagat acgctgctga ccttcacttt cagcacctcc       360
     ttatccctga agaacagtca aaagacgatg ctgctggagg tgataaagag cttcaccccg       420
     ttgccaccgg agaatgacat ccaaaaggac cagccgcgct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page