(data stored in ACNUC10821 zone)

EMBL: AP010958.PE574

AP010958.PE574       Location/Qualifiers
FT   CDS_pept        complement(629471..631372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0574"
FT                   /product="putative Vgr protein"
FT                   /note="RhsK"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29438"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2T0"
FT                   /protein_id="BAI29438.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVHPPLWRAGL
FT                   RQNFRIFQNEDIKSILGTMLQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAYKSTDQSLVLCDTVRHLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFEQEGQHQDYQRTQYEVYDYPGRFKSAHGQNFARWQMDGWR
FT                   NNAETARGMSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRQGAGTA
FT                   LENHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   ADQDSSCWIRVAQAWAGTGFGHLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYMGSGFNELKFDDATGREQVYIHAQKNMDTEVLNDRTTTVKHDH
FT                   RETVKNDQTVTIQEGNRLLTVEKGHKITGVLKGSLSEDVFQDRSTIAGSVHVDAVNNGG
FT                   EGDGIQAYTAIKEILLAVEESKIALTPDGIQLQVGESTVIRLSKDGITIVGGSVFIN"
     atgtcaaccg gattacgttt cacactggaa gtggacggcc tgccgccgga cgcttttgcg        60
     gtggtttcct ttcatctgaa ccagtcactc tcttcgctct tttccctcga tctctccctg       120
     gtcagccagc agtttctctc ccttgaattt gcgcaggtgc tggacaaaat ggcctacctg       180
     acgatatggc agggcgatga cgtacagcgc cgggtgaaag gcgtggtgac ctggtttgaa       240
     ctcggggaga acgacaaaaa ccagatgctg tacagcatga aggtgcaccc gccgctgtgg       300
     cgtgccggtc tgcgccagaa cttccgtatc ttccagaacg aggacatcaa aagcatcctc       360
     ggcacgatgt tgcaggaaaa cggggtgacc gaatggagtc cgctgttcag cgagccgcat       420
     ccttcccgtg agttttgtgt ccagtacggt gagactgatt acgatttcct gtgccggatg       480
     gcggcggagg aaggcatctt cttttatgag gagcatgctt acaaaagtac cgaccagagc       540
     ctggtgctgt gcgacacagt ccgccatctg cccgaatctt ttgaaatccc ctggaatccg       600
     aacacccgta ccgaggtgag caccctctgc atcagccagt tccgctacag cgcacaaatc       660
     cgcccttctt ccgtggtgac caaagactac acctttaaac gccccggctg ggccggacgt       720
     tttgaacagg aaggccagca ccaggactac cagcgcacgc agtatgaagt gtatgactac       780
     cccggacgtt tcaagagcgc ccacgggcag aactttgccc gctggcagat ggacggctgg       840
     cgaaacaacg cagaaaccgc gcggggaatg agccgctcgc cggagatatg gccgggacgg       900
     cgaattgtgc tgacggggca tccgcaggcg aacctgaacc gggaatggca ggtggtggca       960
     agtgaactgc acggcgaaca gccacaggcg gtgccaggac ggcagggagc ggggacggcg      1020
     ctggagaacc attttgcggt gatcccggca gacagaacat ggcgaccaca gccgttgctg      1080
     aaaccgctgg tcgacggccc gcagagcgct gtcgtgacag gaccggcagg cgaggaaatc      1140
     ttctgcgacg aacatggtcg cgtgcgggtg aagttcaact gggaccgtta taacccggca      1200
     gaccaagaca gttcgtgctg gatccgtgtg gcacaggcgt gggcaggcac cggttttggc      1260
     cacctggcga taccgcgtgt gggtcaggag gtgattgtag acttcctcaa cggcgatccg      1320
     gaccagccga tcattatggg gcgcacctac caccaggaaa accgcacccc cggcagcctg      1380
     ccgggaacaa agacgcagat gaccatccgc tccaaaacgt acatgggcag cggatttaat      1440
     gagctgaagt ttgatgatgc gacagggaga gaacaggtct acatccacgc gcagaagaac      1500
     atggataccg aagtgctcaa cgaccgtacc accaccgtaa aacacgatca ccgcgaaacc      1560
     gtaaaaaatg accagacggt cacgatccag gaaggtaacc gccttcttac ggtggaaaaa      1620
     ggccacaaga tcaccggagt actgaaaggg tctttatctg aggatgtctt tcaggacaga      1680
     agcacgattg ccggttcggt gcatgttgac gctgtaaaca atggtggcga aggcgacggt      1740
     atacaggctt atacggcgat taaggaaatt ttgctggccg tggaggaaag caaaattgcg      1800
     ctgacgccgg atggcattca gctacaggtc ggggaatcga cggtaatcag gctgtcgaag      1860
     gatggcatca ccatcgtggg cggttctgtt ttcatcaact ga                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page