(data stored in ACNUC10821 zone)

EMBL: AP010958.PE588

AP010958.PE588       Location/Qualifiers
FT   CDS_pept        646878..647129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECO103_0588"
FT                   /product="regulatory peptide MokC"
FT                   /note="The MokC translation enables hok (gef) expression."
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29452"
FT                   /db_xref="GOA:C8U2U4"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2U4"
FT                   /protein_id="BAI29452.1"
FT                   /translation="MKPQEIFLSILGLPLRASTTRMVVPSSHGGNINMLTKYALVAVIV
FT                   LCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK"
     atgaagcccc aggagatatt tctatcaatc ctggggctgc cactccgagc ctcaacaact        60
     cggatggtag tcccttcttc gcatggaggc aatataaaca tgctgacgaa atatgccctt       120
     gtggcagtca tagtgctgtg tttgacggta ctgggattta cgcttctggt cggagactcg       180
     ctgtgtgagt tcaccgtaaa ggaacgtaat attgagttta aggctgttct cgcttacgaa       240
     ccgaagaagt ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page