(data stored in ACNUC10821 zone)

EMBL: AP010958.PE663

AP010958.PE663       Location/Qualifiers
FT   CDS_pept        725882..727759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0663"
FT                   /product="rhomboid family protein"
FT                   /note="similar to c0741 [Escherichia coli CFT073], 92.0%
FT                   identity in 625 aa overlap, GeneHacker: Min.length=60,
FT                   Min.score =15, overlap=0.4"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29526"
FT                   /db_xref="GOA:C8U318"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C8U318"
FT                   /protein_id="BAI29526.1"
FT                   /translation="MSASSVKPLNVQLPAITLILFALCIGIFCYLAQWMSYEEVDQSAL
FT                   IHLGANVAPLTLSGEPWRLLSSIFLHSSVSHLLMNMFAFLVVGGVAEQILGKWRLLITW
FT                   LFSGVFGGLISACYALRESEQIVISVGASGAILGIAGAAIATQFASGTGTYHKNQRRVF
FT                   PLLGMVALTLLYGARQTGIDNACHIGGLIAGGALGWLSARLSGQNRLVTEGGIIVAGSL
FT                   LLTGAIWLAQQQMDESVLQVRQSLREAFYPQEIEQERRQKKQQLAEERNALRETLSAPV
FT                   SREQANGDLLAEIADIHDMAISRDGNTLYAAIEDTNSIVVFDLGQKKILHTFTAPIAKE
FT                   KSVKHCGGCKDQGVRSLALSPDEKLIYATSFEANALSVINVATGEIIQSITTGAHPDSL
FT                   ILSRDGTKAWVMNRTSNSVSAIDLVAYQHVADIPLEKYDGTGTSGKPGAWVMALSPDER
FT                   TLLVPGEGRGNIVRINTITHQKEDFPAGDARGTISAMRFRPENGEVIFADSQGISRISI
FT                   GDQQTSIMTQWCSRSVYSVEGISPDGQYLALVSYGLQGYVILLNINAGQIIGVYPASYV
FT                   NHLRFSADGRKIFVMAKNGLIQMDRTRSLDPQAIIRHPQYGNVACIPEP"
     atgtctgcat cttcggttaa gccgttaaat gttcaattac ccgcaataac ccttatcctt        60
     tttgcactct gtattgggat attttgttat ctcgcacaat ggatgagtta tgaagaggtc       120
     gatcaatccg cacttatcca tctcggcgca aacgttgcgc ctcttacttt gtcgggtgaa       180
     ccctggcgct tattgagcag tatctttctg cacagtagtg tttctcatct gctgatgaat       240
     atgtttgcat tcctggtcgt gggaggcgtg gcggaacaga ttctggggaa atggcgactc       300
     ctgattacct ggttattctc cggcgtcttt ggtgggctca tcagcgcctg ttatgcgtta       360
     cgcgaaagtg agcagatagt catcagcgtt ggggcatccg gggcgattct gggaatagct       420
     ggtgcagcga tagcaacaca gtttgcttca ggtacgggca cataccataa aaaccagcgg       480
     cgagtatttc ctctgttggg tatggtggcg ctgacactgt tgtacggtgc ccggcaaaca       540
     ggaatagata acgcttgcca cattggcggc ctgattgcgg gtggcgcgtt gggttggctg       600
     agcgcgcgtt tatctgggca aaaccgactc gttacggaag gcgggattat tgttgcgggc       660
     agtcttcttc tgaccggggc tatctggctt gcgcagcagc agatggatga gtcagtttta       720
     caagtcaggc aaagcctgcg tgaagcgttt tatccacagg agattgaaca agagcgacgg       780
     caaaaaaagc agcagttagc ggaggaacgc aacgccctca gggaaacatt atccgctccg       840
     gtaagtcgtg aacaggccaa tggtgatttg ctcgctgaga ttgccgatat ccatgatatg       900
     gcgatcagtc gggatggtaa tacgttgtat gccgcaattg aagacaccaa cagcattgtt       960
     gttttcgacc tcggacaaaa gaaaatcctg cataccttta cagcgcccat agcgaaagaa      1020
     aagtcagtca aacattgtgg tggctgtaaa gatcagggcg tcagatcgct ggcattaagc      1080
     ccggatgaaa agttgattta tgcgacttca tttgaagcga atgcgttatc ggtcattaac      1140
     gtggcgacag gggagattat tcagtcgatt accaccggtg cacatcctga cagtcttatc      1200
     ctctcgcgtg atggcacaaa agcctgggtg atgaatcgca ccagtaatag tgtgtcagcc      1260
     attgatctgg tggcttatca gcatgtggcg gatatcccgc tggagaaata cgacgggacg      1320
     gggacgagcg gtaaaccagg cgcctgggtt atggcacttt ccccggatga aagaacatta      1380
     ctggttccgg gagaaggcag aggtaacatc gtgcggatca ataccatcac gcatcagaaa      1440
     gaagactttc ccgcaggtga tgcgcgtgga acgatatcgg cgatgcgttt tcgacctgaa      1500
     aacggcgagg ttatttttgc cgatagtcag gggatttcac gtataagcat aggggatcaa      1560
     caaaccagca ttatgacgca atggtgtagc aggagcgttt attccgttga gggtattagc      1620
     ccggacggtc aatatttagc gttggtgtca tatggactgc aaggttatgt catcctgctc      1680
     aatattaatg ccgggcagat tattggcgtt tatcctgcca gctacgttaa tcaccttcgt      1740
     ttttcagcgg atggtagaaa aatatttgtc atggcgaaga acgggttgat ccaaatggac      1800
     aggacgcgct cgcttgatcc gcaggcaatt attcgtcatc cccaatatgg caatgtggct      1860
     tgtatccctg aaccgtaa                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page