(data stored in ACNUC10821 zone)

EMBL: AP010958.PPDD/HCPA

AP010958.PPDD/HCPA   Location/Qualifiers
FT   CDS_pept        complement(118710..119150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD/hcpA"
FT                   /locus_tag="ECO103_0108"
FT                   /product="predicted major pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28986"
FT                   /db_xref="GOA:C8U1H8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1H8"
FT                   /protein_id="BAI28986.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTHYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWTRNCNIQSDSALHQACEDVFRFDDAN"
     atggacaagc aacgcggttt tacacttatc gaattgatgg tggttattgg catcattgcc        60
     attttaagcg ccattggtat tcccgcttat caaaactacc tgcgcaaagc cgcactcacc       120
     gacatgctac aaacctttgt gccttaccgt accgccgtag agttgtgcgc gctggaacat       180
     ggtggattag atacctgcga cggtggcagc aatggcattc cctcgcctac caccacccac       240
     tatgtttcag ccatgagtgt ggcaaaaggc gtggtgtcgc tgaccgggca agaaagtctc       300
     aatggactaa gcgtcgtcat gacaccgggt tgggataacg caaacggcgt caccggctgg       360
     acgcgcaact gcaatattca aagtgacagc gcattgcatc aagcctgcga agatgtcttc       420
     cgctttgatg acgccaacta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page