(data stored in ACNUC10821 zone)

EMBL: AP010958.PRPE

AP010958.PRPE        Location/Qualifiers
FT   CDS_pept        362441..364327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="ECO103_0317"
FT                   /product="predicted propionyl-CoA synthetase"
FT                   /note="contains ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29186"
FT                   /db_xref="GOA:C8U228"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8U228"
FT                   /protein_id="BAI29186.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPEALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGSVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLDQIRQAMEE"
     atgtctttta gcgaatttta tcagcgttcg attaacgaac cggagcagtt ctgggccgag        60
     caggcccggc gtattgactg gcagacgccc tttacgcaaa cgctcgacca cagcaatccg       120
     ccgtttgccc gttggttttg tgaaggccga accaatttgt gccacaacgc tatcgaccgc       180
     tggctggaga aacagccaga ggcactggca ttgattgccg tctcttcgga aacagaagaa       240
     gagcgcacct ttacctttcg ccagctgcat gacgaagtga acgcggtggc ctcaatgttg       300
     cgctcactgg gcgtgcagcg cggcgatcgg gtgctggtgt atatgccgat gattgccgaa       360
     gcgcatatta ctctgctggc ctgcgcgcgc attggtgcta ttcattcggt ggtatttggt       420
     ggttttgcct cgcacagcgt ggcggcgcga attgatgacg ctaaaccggt gctgattgtc       480
     tcggctgatg ccggagcgcg cggtggcaaa atcattccct ataaaaaatt gctcgacgat       540
     gcgataagtc aggcgcagca ccagccacgc catgttttgc tggtggatcg cgggctggcg       600
     aaaatggcgc gcgtcagcgg gcgggatgtc gatttcgcgt cgttgcgcca tcaacacatc       660
     ggcgcgcggg taccggtggc gtggctggaa tccaacgaaa cctcctgcat tctctacact       720
     tccggcacga ccggcaaacc taaaggcgtg cagcgtgacg tcggcggata tgcggtggcg       780
     ctggcgacct cgatggacac catttttggc ggcaaagcgg gcagcgtgtt cttttgcgca       840
     tcggatatcg gctgggtggt ggggcattcg tatatcgttt acgcgccgct gctggcgggg       900
     atggcgacta tcgtttacga aggattgccg acctggccgg actgcggcgt gtggtggaaa       960
     atcgtcgaga aatatcaggt tagccggatg ttctcagcgc cgaccgccat tcgcgtgctg      1020
     aaaaaattcc ctaccgctga aattcgcaaa cacgatctct cgtcgctgga agtgctctat      1080
     ctggctggag aaccgctgga cgagccgacc gccagttggg tgagcaatac gctggatgtg      1140
     ccggtcatcg acaactactg gcagaccgaa tccggctggc cgattatggc gattgctcgc      1200
     ggtctggacg acaggccgac gcgtctggga agccccggcg tgccgatgta tggctataac      1260
     gtgcagttgc ttaatgaagt caccggcgaa ccgtgtggcg tcaacgagaa agggatgctg      1320
     gtggtggaag ggccgctgcc gccgggctgt attcagacca tctggggcga cgacgaccgc      1380
     tttgtgaaga cttactggtc gctgttttcc cgcccggtgt acgccacctt tgactggggc      1440
     atccgtgacg ctgacggtta tcactttatt ctcgggcgca ctgacgatgt aattaacgtt      1500
     gccgggcatc gtctgggcac gcgcgagatt gaagagagta tctccagcca tccgggcgtt      1560
     gccgaagtgg cggtggttgg ggtgaaagat gcgctgaaag ggcaggtggc ggtggcgttt      1620
     gtcattccga aagagagcga tagtctggaa gatcgtgatg tggcgcattc gcaagagaag      1680
     gcgattatgg cgctggtgga cagccagatt ggcaactttg gtcgcccggc gcacgtctgg      1740
     tttgtctcgc aattgccgaa aacgcgatcc ggaaaaatgc tgcgccgcac gatccaggca      1800
     atttgcgaag gacgcgatcc tggggatctg acgaccattg atgatcctgc gtcattggat      1860
     cagatccgcc aggcgatgga agagtaa                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page