(data stored in ACNUC10821 zone)

EMBL: AP010958.PSIF

AP010958.PSIF        Location/Qualifiers
FT   CDS_pept        409701..410021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECO103_0359"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29228"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:C8U270"
FT                   /protein_id="BAI29228.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAEKTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     atgaaaataa cattactggt taccttgctt tttggtctgg tttttttaac caccgtcggc        60
     gctgccgaga aaaccttaac cccacaacaa cagcgtatga cctcctgtaa tcagcaggcg       120
     acggcgcagg cgttgaaagg ggatgctcgt aagacctaca tgagtgattg cctgaagaac       180
     agcaagtctg cgcctggtga aaaaagtttg acgccacagc agcaaaagat gcgcgaatgt       240
     aataatcaag caacgcaaca atctctgaaa ggtgatgatc gtaataagtt tatgagtgcc       300
     tgcctcaaga aagccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page