(data stored in ACNUC10821 zone)

EMBL: AP010958.SECA

AP010958.SECA        Location/Qualifiers
FT   CDS_pept        109996..112701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ECO103_0100"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28978"
FT                   /db_xref="GOA:C8U1H0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1H0"
FT                   /protein_id="BAI28978.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   NWQAEVAALENPTVGQIEKIKADWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
     atgctaatca aattgttaac taaagttttc ggtagtcgta acgatcgcac cctgcgccgg        60
     atgcgcaaag tggtcaacat catcaatgcc atggaaccgg agatggaaaa actctccgac       120
     gaagaactga aagggaaaac cgcagagttt cgtgcacgtc tggaaaaagg cgaagtgctg       180
     gaaaatctga tcccggaagc tttcgccgtg gtacgtgagg caagtaagcg cgtctttggt       240
     atgcgtcact tcgacgttca gttactcggc ggtatggttc ttaacgaacg ctgcatcgcc       300
     gaaatgcgta ccggtgaagg taaaaccctg accgcaacgc tgcctgctta cctgaacgca       360
     ctaaccggta aaggcgtgca cgtagttacc gtcaacgact acctggcgca acgtgacgcc       420
     gaaaacaacc gtccgctgtt tgaattcctt ggcctgactg tcggtatcaa cctgccgggc       480
     atgccagcac cggcaaagcg cgaagcttac gcagctgaca tcacttacgg tacgaacaac       540
     gaatacggct ttgactacct gcgcgacaat atggcgttca gccctgaaga acgtgtacag       600
     cgtaaactgc actatgcgct ggtggacgaa gtggactcca tcctgatcga tgaagcgcgt       660
     acaccgctga tcatttccgg cccggcagaa gacagctcgg aaatgtataa acgcgtgaat       720
     aaaattattc cgcacctgat ccgtcaggaa aaagaagact ccgaaacctt ccagggcgaa       780
     ggccacttct cggtggacga aaaatctcgc caggtgaacc tgaccgaacg tggtctggtg       840
     ctgattgaag aactgctggt gaaagagggc atcatggatg aaggggagtc tctgtactct       900
     ccggccaaca tcatgctgat gcaccacgta acggcggcgc tgcgcgctca tgcgctgttt       960
     acccgcgacg tcgactacat cgttaaagat ggtgaagtta tcatcgttga cgaacacacc      1020
     ggtcgtacca tgcagggccg tcgctggtcc gatggtctgc accaggctgt ggaagcgaaa      1080
     gaaggtgtgc agatccagaa cgaaaaccaa acgctggctt cgatcacctt ccagaactac      1140
     ttccgtctgt atgaaaaact ggcggggatg accggtactg ctgataccga agctttcgaa      1200
     tttagctcca tctacaagct ggataccgtc gttgttccga ccaaccgtcc aatgattcgt      1260
     aaagatctgc cggacctggt ctacatgact gaagcggaaa aaattcaggc gatcattgaa      1320
     gatatcaaag aacgtactgc gaaaggccag ccggtgctgg tgggtactat ctccatcgaa      1380
     aaatcggagc tggtgtcaaa cgaactgacc aaagccggta ttaagcacaa cgtcctgaac      1440
     gccaaattcc acgccaacga agcggcgatt gttgctcagg caggttatcc ggctgcggtg      1500
     actatcgcga ccaatatggc gggtcgtggt acagatattg tgctcggtgg taactggcag      1560
     gcagaagttg ccgcgctgga aaatccgacc gtagggcaaa ttgaaaaaat taaagccgac      1620
     tggcaggtac gtcacgatgc ggtactggaa gcaggtggcc tgcatatcat cggtaccgag      1680
     cgtcacgaat cccgtcgtat cgataaccag ttgcgcggtc gttctggtcg tcagggggat      1740
     gctggttctt cccgtttcta cctgtcgatg gaagatgcgc tgatgcgtat ttttgcttcc      1800
     gaccgagtat ccggcatgat gcgtaaactg ggtatgaagc caggcgaagc cattgaacac      1860
     ccgtgggtga ctaaagcgat tgccaacgcc cagcgtaaag ttgaaagtcg taacttcgac      1920
     attcgtaagc aactgctgga atatgatgac gtggctaacg atcagcgtcg cgccatttac      1980
     tcccagcgta acgaactgct ggatgtcagc gatgtgagcg aaaccatcaa cagcattcgt      2040
     gaagatgtgt tcaaagccac cattgatgcc tacattccgc cacagtcgct ggaagaaatg      2100
     tgggatattc cggggctgca ggaacgtctg aagaacgatt tcgacctcga tttaccaatt      2160
     gccgagtggc tggataaaga accagaactg catgaagaga cgctgcgtga gcgcattctg      2220
     gcgcagtcca tcgaagtgta tcagcgtaaa gaagaagtgg ttggtgctga gatgatgcgt      2280
     cacttcgaga aaggcgtcat gctgcaaacg cttgactccc tgtggaaaga gcacctggca      2340
     gcgatggact atctgcgtca gggtatccac ctgcgtggct atgcacagaa agatccgaag      2400
     caggaataca aacgtgaatc gttctccatg tttgcagcga tgctggagtc gttaaaatat      2460
     gaagttatca gcacgctgag caaagtccag gtacgtatgc ctgaagaggt tgaggagctg      2520
     gaacaacagc gtcgtatgga agccgagcgt ttagcgcaaa tgcagcagct tagccatcag      2580
     gatgacgact ctgcagccgc agctgcactg gcggcgcaaa ccggtgagcg caaagtagga      2640
     cgtaacgatc cttgcccgtg cggttctggt aaaaaataca agcagtgcca tggtcgcctg      2700
     caataa                                                                 2706
//

If you have problems or comments...

PBIL Back to PBIL home page