(data stored in ACNUC10821 zone)

EMBL: AP010958.SFMA

AP010958.SFMA        Location/Qualifiers
FT   CDS_pept        565358..565900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="ECO103_0502"
FT                   /product="predicted fimbrial-like adhesin protein SfmA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29369"
FT                   /db_xref="GOA:C8U2L1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2L1"
FT                   /protein_id="BAI29369.1"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNT
FT                   DSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQVDAINDNL
FT                   LAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTS
FT                   ASAGQANADATFIMRYE"
     atgaaattaa gatttatttc gtctgcgctg gctgccgcac tattcgccgc tacgggtagt        60
     tatgctgccg ttgtagatgg cggtacaatt cactttgaag gcgaactggt gaatgctgcc       120
     tgttcagtga atactgactc ggcagaccag gttgtcacac tcggtcaata tcgtaccgat       180
     attttcaatg ctgttggtaa tacctctgca ttaattccat tcaccattca gttgaacgac       240
     tgcgatcctg ttgttgccgc taatgctgcc gttgcatttt ctggtcaggt tgatgcaatc       300
     aatgataatt tattggccat tgcatccagt accaatacaa caacagcaac gggtgtcggt       360
     attgaaatac ttgataatac atccgcaatt ctcaaacctg atgggaatag cttctcaacc       420
     aaccagaact tgatccccgg aaccaacgtt cttcattttt ctgcacgtta taaaggcacc       480
     ggtacaagtg catcagcagg gcaagcaaat gctgacgcga cttttattat gagatacgaa       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page