(data stored in SCRATCH zone)

EMBL: AP010958.SFMF

AP010958.SFMF        Location/Qualifiers
FT   CDS_pept        570482..570997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECO103_0506"
FT                   /product="predicted fimbrial-like adhesin protein SfmF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29373"
FT                   /db_xref="GOA:C8U2L5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2L5"
FT                   /protein_id="BAI29373.1"
FT                   /translation="MRRALFSCFCGLLWISSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTIAIELRNSDRSRLALGAASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     atgagaagag cactctttag ctgtttctgc gggttactgt ggatttccag tggatgggca        60
     gctgaccctt tgggaacgat taatatcaat ttgcacggta acgttgttga tttctcctgt       120
     accgtaaaca ctgcggatat tgataagacg gtagatttag gcagatggcc tacgacacaa       180
     ttactgaacg ctggcgatac cacggcactc gtccctttta gcctgcggct ggagggatgt       240
     cctccgggtt cagttgcgat tttatttacg ggaacgccgg catccgatac caacctgctg       300
     gctctggatg atcccgcaat ggcgcaaacc atcgccatcg aattacgtaa tagcgatcgc       360
     tcccggctcg cactgggagc ggcgagcccg actgaggaag tagatgcaaa tggcaatgtc       420
     acactaaact tttttgccaa ttatcgagcg ttagccagcg gtgttcggcc aggtgtggcg       480
     aaagcggatg cgatatttat gatcaattat aattaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page