(data stored in ACNUC10821 zone)

EMBL: AP010958.SFMH

AP010958.SFMH        Location/Qualifiers
FT   CDS_pept        569494..570471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECO103_0505"
FT                   /product="predicted fimbrial-like adhesin protein SfmH"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29372"
FT                   /db_xref="GOA:C8U2L4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2L4"
FT                   /protein_id="BAI29372.1"
FT                   /translation="MACLCLANISWATVCANSTGVAEDEHYDLSNIFNSTNNQPGQIVV
FT                   LPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLNDYLLGAMSLVDSV
FT                   MDIQFPPQNYILMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIPRQVMFTVYVT
FT                   STPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAGVM
FT                   PQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDLNS
FT                   VIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
     atggcatgtt tgtgtctggc aaacatatcc tgggctactg tttgtgcaaa tagtactggc        60
     gtagcagaag atgaacacta tgatctctca aatatcttta atagcaccaa taaccagcca       120
     gggcagattg ttgttttacc ggaaaaatcc ggctgggtag gtgtctcagc aatttgtcca       180
     cccggtacgc tggtgaatta tacataccgt agttatgtca ccaactttat tgttcaggaa       240
     actatcgata attataaata tatgcaatta aatgattatc tattaggtgc gatgagtctg       300
     gttgatagtg tgatggatat tcagttcccc ccgcaaaatt atattctgat gggaacagat       360
     cctaacgttt cgcaaaacct tccattcggg gtgatggatt ctcgtttaat atttcgttta       420
     aaggttattc gtccctttat taacatggtg gagatcccca gacaggtgat gtttaccgtg       480
     tatgtgacat caacgcctta cgatccgttg gttacacctg tttataccat tagttttggt       540
     ggccgggttg aagtaccgca aaactgcgaa ttaaatgccg ggcagattgt tgaatttgat       600
     tttggtgata tcggcgcatc gttatttagt gcggcagggc cgggtaatcg acctgctggt       660
     gtcatgccgc aaaccaagag cattgcggtc aaatgtacga atgttgctgc gcaggcttat       720
     ttaacaatgc gtctggaagc cagtgccgtt tctggtcagg cgatggtgtc ggacaatcag       780
     gatttaggtt ttattgtcgc cgatcagaac gatacgccga tcacgcctaa cgatctcaat       840
     agcgttattc ctttccgtct ggatgcagct gcggcagcca atgtcacact tcgcgcctgg       900
     cctatcagta ttaccggtca aaaaccgacc gaagggccgt ttagcgcgct ggggtattta       960
     cgcgtcgatt atcaatga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page