(data stored in SCRATCH zone)

EMBL: AP010958.TAUA

AP010958.TAUA        Location/Qualifiers
FT   CDS_pept        392842..393804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECO103_0344"
FT                   /product="taurine transporter subunit TauA"
FT                   /note="periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29213"
FT                   /db_xref="GOA:C8U255"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:C8U255"
FT                   /protein_id="BAI29213.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGASVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDYAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
     atggcaattt catcgcgtaa cacacttcta gccgcactgg cattcatcgc ttttcaggca        60
     caggcggtga acgtcaccgt ggcctatcaa acctcagccg aaccggcgaa agtggctcag       120
     gccgacaaca cctttgctaa agagagcggg gcgagcgtgg actggcgtaa gtttgacagc       180
     ggagccagca tcgtgcgggc gctggcttca ggcgatgtgc aaatcggcaa cctcggttcc       240
     agcccgttag cggttgcagc cagccaacag gtgccgattg aagtcttctt gctggcgtca       300
     aaactgggta actccgaagc gctggtggta aagaaaacta tcagcaaacc ggaagatctg       360
     attggcaaac gcatcgccgt accgtttatc tccaccaccc actacagcct gctggcggcg       420
     ctgaaacact ggggcattaa acccgggcaa gtggagattg tgaacctgca gccgcccgcg       480
     attatcgctg cctggcagcg gggagatatt gatggtgctt atgtctgggc accggcggtt       540
     aacgccctgg aaaaagacgg caaggtgttg accgattctg aacaggtcgg gcagtggggc       600
     gcgccaacgc tggacgtctg ggtggtgcgc aaagattatg ccgagaaaca tcctgaggtc       660
     gtgaaagcgt tcgctaaaag cgccatcgat gctcagcaac cgtacattgc taacccagac       720
     gtgtggctga aacagccgga aaacatcagc aaactggcgc gtttaagcgg cgtgcctgaa       780
     ggtgacgttc cggggctggt gaaggggaat acctatctga cgccgcagca acaaacggca       840
     gaactgaccg gaccggtgaa caaagcgatc atcgacaccg cgcagttttt gaaagagcag       900
     ggcaaggtcc cggctgtagc gaatgattac agccagtacg ttacctcgcg cttcgtgcaa       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page