(data stored in ACNUC10821 zone)

EMBL: AP010958.TAUC

AP010958.TAUC        Location/Qualifiers
FT   CDS_pept        394581..395408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ECO103_0346"
FT                   /product="taurine transporter subunit TauC"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29215"
FT                   /db_xref="GOA:C8U257"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8U257"
FT                   /protein_id="BAI29215.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVVIGIPVGIA
FT                   MGLSPTVRGILDPVIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
     atgagtgtgc tcattaatga aaaactgcat tcgcggcggc tgaaatggcg ctggccgctc        60
     tcgcgtcagg tgaccttaag cattggcacg ttagcggttt tactcactgt atggtggacg       120
     gtggcggcgc tgcaactgat tagcccgctg tttttgccgc cgccgcaaca agtactggca       180
     aaactgctca ccattgccgg accgcaggga tttatggacg ccacgctgtg gcagcatctg       240
     gcagccagcc tgacgcgcat tgtgctggcg ctactcgcgg cggtggtgat cggtattccg       300
     gtcgggatcg ccatggggct aagcccgacg gtgcgcggca ttctggatcc ggtaatcgaa       360
     ctttatcgtc ccgtgccgcc gctggcttat ttgccgctga tggtgatctg gtttggtatt       420
     ggtgaaacct cgaagatctt actgatctat ttagcgattt ttgcaccggt ggcgatgtcg       480
     gcgctggcgg gggtgaaaag cgcgcagcag gttcgcattc gtgccgccca gtcgctgggt       540
     gccagccgtg cgcaggtgct gtggtttgtc attttgcccg gcgcgctgcc ggaaatcctc       600
     accggattac gcattggtct gggtgtgggc tggtctacgc tggtagcggc ggagctgatt       660
     gccgcgacgc gcggtttagg atttatggtt cagtcagcgg gtgaatttct cgcgactgac       720
     gtggtgctgg cgggaatcgc ggtgattgcg attatcgcct ttcttttaga actgggtttg       780
     cgcgcgttac agcgccgtct gacgccctgg catggagaag tacaatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page