(data stored in ACNUC10821 zone)

EMBL: AP010958.TBPA

AP010958.TBPA        Location/Qualifiers
FT   CDS_pept        complement(76214..77197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="ECO103_0069"
FT                   /product="thiamin transporter subunit TbpA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28947"
FT                   /db_xref="GOA:C8U1D9"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1D9"
FT                   /protein_id="BAI28947.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPKIKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     gtgttaaaaa aatgtcttcc cctgctgttg ctgtgcacag cgcccgtttt cgctaaaccc        60
     gttctgactg tttataccta cgattccttc gccgccgact gggggcctgg tccaaagatc       120
     aaaaaagctt ttgaagccga ctgtaactgc gaactgaaac tggtggcgct ggaagatggc       180
     gtttcgcttc tcaaccgtct acggatggaa ggcaaaaata gtaaagccga tgtggtgctg       240
     gggctggata acaatctgtt agacgccgcc agtaaaaccg gactatttgc caaaagcggt       300
     gtggcagcgg atgccgttaa cgttcccggc ggctggaata atgacacttt cgtcccgttt       360
     gattacggct atttcgcctt cgtctatgac aagaacaaac tgaaaaaccc gccgcaaagc       420
     ctgaaagaat tggttgagag cgatcagaac tggcgggtga tttatcagga tccgcgcacc       480
     agtacgccgg ggctgggcct gctgttgtgg atgcaaaaag tctatggcga tgacgcccca       540
     caagcctggc aaaaactggc gaagaaaacc gtcacggtca ccaaaggctg gagcgaagcc       600
     tacggcctgt ttttaaaagg tgaaagcgat ctggtactga gttacaccac ctctccggct       660
     tatcacattc tcgaagagaa aaaagataac tacgccgccg cgaactttag cgaaggtcac       720
     tatctgcagg tggaagtcgc cgcccgcacc gctgccagca agcagccgga gctggcgcaa       780
     aaattcctcc agtttatggt ttctccggct tttcagaatg cgatcccaac cggtaactgg       840
     atgtatccgg tggcaaatgt cacgctgcct gccgggtttg aacaattgac caaaccggcc       900
     accacgctgg agttcacacc agctgaagtg gcggcacaac gtcaggcatg gattagcgaa       960
     tggcaacgcg ccgtcagccg ttaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page