(data stored in ACNUC10821 zone)

EMBL: AP010958.THIL

AP010958.THIL        Location/Qualifiers
FT   CDS_pept        441950..442927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECO103_0391"
FT                   /product="thiamin-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29259"
FT                   /db_xref="GOA:C8U2A1"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2A1"
FT                   /protein_id="BAI29259.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLHDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVEPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTFDWKGYDHFATP"
     atggcatgtg gcgagttctc cctgattgcc cgttattttg accgtgtaag aagttctcgt        60
     cttgatgtcg aactgggcat cggcgacgat tgcgctcttc tcaatatccc cgagaaacag       120
     accctggcga tcagcactga tacgctggtg gcgggcaacc acttcctcca tgatatcgat       180
     cctgctgatc tggcgtataa agcactggcg gtgaacctaa gcgatctggc agcgatgggg       240
     gccgatccgg cctggctgac gctggcatta accttaccgg acgtagacga agcgtggctt       300
     gagtccttca gcgacagttt gtttgatctt ctcaattatt acgatatgca actcattggc       360
     ggcgatacca cgcgtgggcc attatcaatg acgttgggta tccacggctt tgttccgatg       420
     ggacgagcct taacgcgctc tggagcgaaa ccgggtgact ggatctatgt gaccggtaca       480
     ccgggcgata gcgccgccgg gctggcgatt ttgcaaaacc gtttgcaggt tgccgatgct       540
     aaagatgcgg actacttgat caaacgtcat ctccgtccat cgccgcgtat tttacaggga       600
     caggcactgc gcgatctggc aaattcagct atcgatctct ctgacggtct gatttccgat       660
     ctcgggcata tcgtgaaagc cagcgactgc ggcgcacgta ttgacctggc attgctgccg       720
     ttttctgatg cgctttctcg ccatgttgaa ccggaacagg cgctgcgctg ggcgctctct       780
     ggcggtgaag attacgagtt gtgtttcact gtgccggaac tgaaccgtgg cgcgctggat       840
     gtggctctcg gacacctggg cgtaccgttt acctgtatcg ggcaaatgac cgccgatatc       900
     gaagggcttt gttttattcg tgacggcgaa cctgtcacgt ttgactggaa aggatatgac       960
     cattttgcca cgccataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page