(data stored in SCRATCH zone)

EMBL: AP010958.YAAH

AP010958.YAAH        Location/Qualifiers
FT   CDS_pept        complement(11206..11772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="ECO103_0011"
FT                   /product="conserved predicted inner membrane protein"
FT                   /note="associated with acetate transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28894"
FT                   /db_xref="GOA:C8U186"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C8U186"
FT                   /protein_id="BAI28894.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTALPIGESH"
     atgggcaaca ctaagttggc taatccggca ccgctgggcc tgatgggctt cggcatgacc        60
     accattctgc ttaacctgca caacgtgggt tatttcgctc tggacggtat tattcttgcc       120
     atgggcattt tctacggcgg catcgcgcaa atttttgctg gtctgctgga gtacaaaaaa       180
     ggcaacactt tcggtttaac cgcattcacc tcttacggtt ctttctggct gacgctggtt       240
     gcgattctgc tgatgccgaa actgggtctg accgatgcgc caaatgcaca gttccttggt       300
     gtctacctgg gtctgtgggg cgtatttacg ctgtttatgt tcttcggcac gctgaaaggc       360
     gcacgcgttc tgcaattcgt tttctttagc ctgaccgtgc tgtttgccct gctggcgatc       420
     ggtaacattg ccggtaacgc cgcaatcatc cactttgccg gctggattgg gctgatctgc       480
     ggtgccagcg caatctatct ggcgatgggt gaagtactga acgagcagtt tggtcgcacc       540
     gctctgccga ttggtgaatc ccactaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page