(data stored in ACNUC10821 zone)

EMBL: AP010958.YAAI

AP010958.YAAI        Location/Qualifiers
FT   CDS_pept        complement(12660..13064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECO103_0013"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28896"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/TrEMBL:C8U188"
FT                   /protein_id="BAI28896.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKILGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
     atgaaatccg tttttacgat ttccgccagc ctggcgatta gtctgatgct gtgctgcacg        60
     gcgcaggcaa acgaccataa aatcctcggc gtcattgcaa tgccgcgtaa cgaaaccaac       120
     gatctggcgt tgaaacttcc tgtttgccga attgttaaac gcatacaact ctctgccgac       180
     catggcgatt tacagttaag cggtgcatcg gtttatttca aagccgcccg tagcgccagt       240
     cagagcctga atattccttc agaaataaaa gaagggcaaa ccactgactg gatcaacatt       300
     aacagcgata acgacaataa acgctgcgtc tcaaaaatca ccttttccgg tcatacggtg       360
     aactcatcgg atatggccac gctgaaaatt atcggcgacg actaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page