(data stored in ACNUC10821 zone)

EMBL: AP010958.YAAW

AP010958.YAAW        Location/Qualifiers
FT   CDS_pept        complement(11921..12634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECO103_0012"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28895"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:C8U187"
FT                   /protein_id="BAI28895.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKNMDEEHKQEFLHAIDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
     atgaatgtta attacctgaa tgattcagat ctggattttc tccagcattg cagtgaggaa        60
     cagttggcaa atttcgcccg attgctcacc cataatgaaa aaggcaaaac tcgcctctcc       120
     agcgtactga tgcgcaacga actgtttaaa tcgatggaag ggcatcccga gcaacatcgc       180
     cgcaactggc agctgattgc tggagaatta cagcattttg gtggcgatag tatcgccaac       240
     aaactgcgcg gacacggtaa attgtatcgg gccattttgc tcgatgtttc aaaacgattg       300
     aagctgaaag ccgacaaaga gatgtctacg tttgagattg agcaacagtt actggaacaa       360
     tttctgcgta acacctggaa gaatatggac gaggaacata agcaggagtt tctgcacgcg       420
     atcgatgcca gggtgaatga gctggaagag ctgctgccgc tgctgatgaa agacaaatta       480
     ttggcaaaag gcgtgtcgca tttgctttcc agccaactga cccgcatttt acgcacccac       540
     gcagcaatga gcgtacttgg gcatggtttg ctgcgcggcg cggggctggg aggccctgta       600
     ggtgcggcac taaatggggt taaagcggtc agcggcagcg cctatcgcgt gacgattcca       660
     gccgtactgc aaatcgcctg cctgcgccgg atggttagcg ccactcaggt ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page