(data stored in ACNUC10821 zone)

EMBL: AP010958.YAAY

AP010958.YAAY        Location/Qualifiers
FT   CDS_pept        24408..24626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="ECO103_0025"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28905"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:C8U197"
FT                   /protein_id="BAI28905.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGHFLPVICAMAMKS
FT                   HFFLISVLNRRLTLTAVQGILGRFSLF"
     atgtgccggc actcgttacg tagtgatggc gcaggattct accagcttgc ggggtgtgaa        60
     tacagctttt ccgcgataaa aattgcagca ggcggtcact ttcttcccgt gatttgcgcc       120
     atggcaatga aaagccactt ctttctgatt tcggtactca atcgccggtt aaccttgacc       180
     gctgtacaag gtatactcgg acgattttca ctgttttga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page