(data stored in ACNUC10821 zone)

EMBL: AP010958.YACH

AP010958.YACH        Location/Qualifiers
FT   CDS_pept        complement(131008..132765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECO103_0117"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28995"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1I7"
FT                   /protein_id="BAI28995.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASTGLYIKSRTVEAPVEPQSTQQ
FT                   TAPDITAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDSLLSQVLMASTYPA
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLT
FT                   ASPVITEPATTVISIEPANPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFIDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAENYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVREKMQTNPQIQQRRDAARERIQSASPEQRQVFKEKVQQR
FT                   PLNQQQRDNARQRVQSASPEQRQVFREKVQESRPQRLNDSNHTVRLNNEQRSAVRERLS
FT                   ERGARRQER"
     atgaaaatga ctttgccgtt taaaccccat gtgctggcgc taatttgcag tgccgggctt        60
     tgtgccgcct ctaccgggct atatataaaa agccgcacag tggaagcgcc tgtggaaccg       120
     caatcgacac aacagactgc gcctgacatc accgcagtta cgcttcctgc aacggtttcc       180
     gcaccgcccg taacgcccgc cgtcgtcaaa tccgcattca gcactgcaca aatcgatcaa       240
     tgggttgcgc ctgtcgcgct gtaccccgat tctctgcttt cacaagtgtt aatggcatca       300
     acctatccgg caaacgttgc tcaagcagtg caatggtcgc acgataatcc acttaaacaa       360
     ggcgatgctg ctattcaggc ggtatctgac cagccgtggg acgccagcgt taaatcactg       420
     gtggcctttc cacaattgat ggcattgatg ggcgaaaacc cgcaatgggt gcaaaacctg       480
     ggcgatgctt ttctggcgca gccgcaggac gtgatggact cggtacagcg attgcggcaa       540
     ctggcgcaac aaaccggttc gctgaagtca tcaaccgaac aaaaagttat taccacaacg       600
     aagaaagctg taccggtaaa acagacagtc acggcacccg tcataccatc caataccgtt       660
     ttaactgcca gccccgtcat tacagagcct gcaacaaccg tcatttccat tgagcccgcc       720
     aatcctgatg tggtctatat tcccaactac aacccaaccg tggtttacgg gaactgggcc       780
     aatactgcgt atccgccggt ttatctgcca ccaccagccg gagaaccgtt tattgacagc       840
     tttgtgcgcg gattcggcta tagcatgggt gttgctacca cgtacgcact attcagcagc       900
     atcgactggg atgacgacga tcatgaccat catcatcatg acgatgatga ttatcatcac       960
     cacgatggcg gtcatcgtga cggtaatggc tggcaacaca acggcgacaa catcaatatc      1020
     gacgtcaaca atttcaaccg tatcaccggt gagcatctta ctgataagaa tatggcatgg      1080
     cggcacaatc caaactaccg taatggtgtg ccctatcatg atcaggatat ggcaaagcgg      1140
     tttcatcaaa ccgatgtcaa cggcggaatg agcgccacgc agctacctgc tccaacacgc      1200
     gacagccagc gtcaggcggc agcaagtcag tttcagcaac gaacacacgc cgcccccgtc      1260
     attacacgag atacccaacg tcaggcagcg gcacagcggt ttaatgaagc tgaaaactat      1320
     gggagctatg acgacttccg cgacttcagc cgtcgccaac cactgaccca gcaacaaaag      1380
     gacgccgctc gtcagcgtta tcagtcggcc tcgcctgagc agcgccaggc agtccgcgag      1440
     aaaatgcaga ctaacccaca gatccagcag cgaagagacg cagcgcgtga gcgtattcag      1500
     tcagcctcgc ctgagcagcg ccaggtgttt aaggaaaaag tacagcagcg cccactgaac      1560
     caacagcaac gtgataacgc ccgccagcgt gttcaatcag catcacctga acaacgtcag      1620
     gtttttcggg aaaaagttca ggagagccgc ccacaacgtc taaacgacag taaccatact      1680
     gtcaggctga ataacgagca acggtcagca gtacgcgaac gtctctctga gcgcggagca      1740
     aggcgacagg aaaggtaa                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page