(data stored in ACNUC10821 zone)

EMBL: AP010958.YADC

AP010958.YADC        Location/Qualifiers
FT   CDS_pept        complement(151064..152338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECO103_0135"
FT                   /product="putative fimbrial-like protein yadC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29013"
FT                   /db_xref="GOA:C8U1K5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR017014"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1K5"
FT                   /protein_id="BAI29013.1"
FT                   /translation="MKKFFRHFLFLILCLSCYTASAGTDDNVGYIVGNSYGVGPSDQKW
FT                   RETGPNGDATVIFRYATSTNNLVFYKPTQLGPTGVKLQWSQLDTASGGGFLYCNRSDST
FT                   SGSAMRIENAMVDSGKMYGSHKLFNTSVPGLYYTLLISNMWSAYGTVTNVSSPGIYIGD
FT                   SAEQYFSWYNPSEDVLYWSCNNANSTRKYWAVGGIYQTLTIEFYTDTNFDPTVTQQIKL
FT                   SSSSNYLYSFKAYGAGQGINEHSYFIKIDFDLLNVKLTNPTCFTAMLSGTSVTGSTVKM
FT                   GEYSAEQIRNGATPVPFDISLQNCVRVTNIETKLVSTKVGTENGQLLGNTLTGNDAAKG
FT                   VGVLIEGLATSKNPLMTLKPNDSNSVYKDYDPRGKDDTTGGVYPDQDTGITYPLHFQAT
FT                   LQQDGTIPIEAGEFKATSTFQVTYP"
     atgaagaaat tcttcagaca ttttcttttt ttaattctgt gcttgagttg ttataccgcg        60
     agtgctggca ctgatgataa cgtaggatat attgttggga atagttacgg cgttggtccg       120
     tcagatcaaa aatggagaga aacggggccg aatggcgatg ctactgtcat attcagatat       180
     gcaacaagta caaataattt agttttctac aaaccgacgc agcttggacc tacaggtgta       240
     aaattacagt ggagtcagtt agataccgct tctggtggtg gttttcttta ttgcaacaga       300
     agtgatagca caagtggtag cgcaatgcgt attgaaaatg caatggttga ctcaggtaaa       360
     atgtatggct cccataaatt atttaataca tcagttcctg gtttgtatta cacattatta       420
     atttcaaaca tgtggtcagc ttacggtacc gtaactaacg ttagttcacc tgggatatac       480
     attggtgact ctgcagaaca atatttttcg tggtataatc caagcgaaga cgtgttatat       540
     tggagttgca ataatgcgaa tagcacccgt aaatactggg ctgtaggtgg tatttatcag       600
     acccttacaa ttgaattcta tacagataca aactttgatc caacagtaac tcaacagatc       660
     aaattatcca gctcatcaaa ttatctgtat tcatttaaag cctatggcgc aggccaaggt       720
     ataaatgagc atagttattt tatcaaaatc gatttcgatc tgctcaatgt caagttgact       780
     aatcccactt gttttaccgc tatgcttagt ggaacttctg tgactggttc tacggtaaaa       840
     atgggtgaat atagtgcaga acaaatcaga aacggtgcca caccggttcc ttttgatatt       900
     tcacttcaaa actgcgttcg tgtgactaat attgagacaa aattagtttc aacaaaggtt       960
     ggtactgaaa acgggcaact ccttggtaat actctcacag gtaatgacgc agcaaaagga      1020
     gtcggtgtac tcatagaagg tttagcaact agtaaaaatc ctctaatgac attgaaacct      1080
     aatgattcaa attctgttta taaagattac gacccgagag gcaaagacga tacaacagga      1140
     ggagtttacc cggatcaaga tacaggtata acataccctc tccatttcca ggccacgcta      1200
     caacaggatg gaactatacc aatagaagct ggtgagttta aagccaccag tactttccag      1260
     gtaacctacc cttaa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page