(data stored in SCRATCH zone)

EMBL: AP010958.YADG

AP010958.YADG        Location/Qualifiers
FT   CDS_pept        144129..145055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="ECO103_0127"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29005"
FT                   /db_xref="GOA:C8U1J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1J7"
FT                   /protein_id="BAI29005.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLAKLKSETFILDLAPKSPLPKLDGYQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVNEKQGDRA"
     atgaccattg cactggaact tcaacagctt aaaaaaactt atccaggcgg cgttcaggcg        60
     cttcgtggaa tagatttgca ggtcgaagcg ggtgattttt atgcgcttct cgggccgaac       120
     ggggccggga aatcgaccac tatcggtatt atcagctctc tggtaaataa aacctccggg       180
     cgggtcagcg tatttggtta cgatctcgag aaagatgtcg tgaacgctaa acgtcagttg       240
     ggactggtgc cgcaggaatt taacttcaac ccgtttgaaa ccgtgcagca aattgtggta       300
     aatcaggcag ggtactacgg tgtggagcgc aaagaggcgt acatccgcag cgaaaaatat       360
     cttaaacaac tcgatctatg gggaaaacgc aacgaacgtg cgcgtatgtt atctggcggg       420
     atgaagcgcc gtttaatgat tgcccgtgcg ttaatgcatg aacctaaact actgattctc       480
     gacgaaccga ccgcaggcgt ggatattgaa cttcgccgct caatgtgggg ctttttgaag       540
     gatttaaacg acaaaggcac caccatcatt ctcaccacac actacctgga agaagcagaa       600
     atgctgtgcc gcaatatcgg cattattcaa cacggtgagc tggtggaaaa tacctcgatg       660
     aaggcgctgc tggctaagct gaaatcggaa acctttattc tcgatctcgc accgaaaagt       720
     ccgttaccga agctcgatgg ctatcagtat cgactggtcg ataccgcgac gctggaagtt       780
     gaagtgctgc gtgagcaggg gatcaacagc gtatttacgc agttaagtga gcagggcatt       840
     caggtattaa gtatgcgtaa caaagctaac cgtctggaag agctgtttgt ttcactggtt       900
     aatgaaaaac aaggagatcg cgcatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page