(data stored in ACNUC10821 zone)

EMBL: AP010958.YADI

AP010958.YADI        Location/Qualifiers
FT   CDS_pept        145927..146367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECO103_0129"
FT                   /product="predicted PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29007"
FT                   /db_xref="GOA:C8U1J9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1J9"
FT                   /protein_id="BAI29007.1"
FT                   /translation="MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGGPEVSSLWHQQQKNPPFVLKHNLYEY"
     atgttaggtt gggtaattac ctgtcacgat gaccgggcgc aagagatact ggatgcgctg        60
     gagaaaaaac atggggcgct tcttcagtgc cgggccgtga atttctggcg tgggttaagc       120
     tctaatatgc tcagccgcat gatgtgcgat gctctgcatg aagcggactc tggtgagggt       180
     gtcatcttct taaccgatat agccggagcg ccaccgtacc gcgtggcttc attattaagc       240
     cacaaacact cccgttgcga agtgatttct ggtgtcacgt taccgttaat tgaacagatg       300
     atggcttgcc gtgaaaccat gaccagttca gagtttcgcg agcgtattgt cgaactgggt       360
     gggccggagg tgagtagtct ttggcaccaa caacaaaaaa atccgccttt cgtcctcaaa       420
     cataatttgt atgagtatta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page