(data stored in ACNUC10821 zone)

EMBL: AP010958.YAEB

AP010958.YAEB        Location/Qualifiers
FT   CDS_pept        complement(219400..220107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="ECO103_0195"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29071"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1R3"
FT                   /protein_id="BAI29071.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDSVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
     atgagcagtt tccagttcga gcaaataggc gttattcgct cgccctataa agaaaaattc        60
     gccgttccgc gccagccagg tctggtaaaa agcgccaacg gcgaactgca tctcattgct       120
     ccctacaacc aggccgacgc cgttcgcggc ctggaagcgt tcagccattt atggatcctt       180
     ttcgtctttc atcaaacgat ggaaggcggc tggcgtccga ctgtgcgtcc accgcgcctc       240
     ggcggtaacg ccagaatggg ggttttcgca acacgctcta ctttccgccc taacccaatt       300
     ggtatgtcgc tggtagagct gaaagaggtt gtttgccata aagacagcgt gattctgaag       360
     ctcggcagtc tggatctggt cgatggtacg ccggtagtgg atatcaaacc gtatctcccc       420
     tttgccgaat cgcttcccga tgccagtgcc agctatgcgc aaagtgcgcc agcggcagag       480
     atggcggtga gttttaccgc agaggtcgaa aagcagcttt tgacgctgga gaagcgttat       540
     ccgcagttaa cgctgtttat ccgcgaagta ctggcgcagg acccacgccc ggcctatcgt       600
     aaaggtgagg aaacgggcaa aacctatgcc gtctggctac atgattttaa cgttcgctgg       660
     cgcgtcaccg acgcaggttt tgaagtcttt gcgctggaac cgcgttaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page