(data stored in ACNUC10821 zone)

EMBL: AP010958.YAEJ

AP010958.YAEJ        Location/Qualifiers
FT   CDS_pept        215392..215814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="ECO103_0190"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29068"
FT                   /db_xref="GOA:C8U1R0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1R0"
FT                   /protein_id="BAI29068.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKKRRLASKAQKSSVKAMRGKVRSGRE"
     atgattgtga tttcccgaca tgttgctatt cccgatggtg agcttgagat caccgccatt        60
     cgtgcgcagg gcgcgggcgg gcagcatgtt aataagacct caacggccat tcatctgcgt       120
     tttgacattc gggcgtccag cctgccagag tattacaaag agcgtctact cgccgccagc       180
     catcatttga tcagcagtga tggcgtgatt gtcattaagg cacaggaata ccgcagtcag       240
     gaactgaacc gcgaagccgc gctagcccgg ctggtggcag tgattaaaga tttaacaaca       300
     gaacaaaaag cccgacgacc cacgcggccc acccgtgcat cgaaaaagcg caggctggca       360
     tcgaaagcac aaaaatcaag cgtgaaggcg atgcgcggca aagtacgcag cggtcgggaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page