(data stored in ACNUC10821 zone)

EMBL: AP010958.YAHC

AP010958.YAHC        Location/Qualifiers
FT   CDS_pept        complement(338513..339010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="ECO103_0295"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29165"
FT                   /db_xref="GOA:C8U207"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:C8U207"
FT                   /protein_id="BAI29165.1"
FT                   /translation="MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSF
FT                   YAAGGSKSGFIRSLAVNYSGMVWAFFAALAAGWLASVSGLSAFWASVITTVPFSAVVVW
FT                   QGRFWLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRD
FT                   GY"
     atgaacggac tcacggcaac gggtgtcacc gtcggtattt gtgcagggct ttggcagtta        60
     gtgtcttcac atgtcgggct ctctcaggga tgggaattat taggaaccat tggcttcgtc       120
     gccttttgca gtttttatgc cgcaggcggc agtaaatcgg ggtttatcag aagtctggcg       180
     gttaattatt ccgggatggt gtgggcattt ttcgccgcgc tggctgccgg ttggctggcc       240
     tctgtaagtg gactgtccgc gttctgggcg agcgtaatta ctaccgtacc cttctcggcg       300
     gtagtggtct ggcaagggcg tttctggtta ctgtccttta ttcccggtgg ctttctcggc       360
     atgacgctgt tttttgccag cgggatgaac tggacggtga cgttactggg ttttctggcg       420
     ggtaactgcg tggggataat ttcagaatat ggtggacaaa aattaagcga agcgacgact       480
     aaacgcgacg ggtattaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page