(data stored in ACNUC10821 zone)

EMBL: AP010958.YAHE

AP010958.YAHE        Location/Qualifiers
FT   CDS_pept        339913..340776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECO103_0297"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29167"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:C8U209"
FT                   /protein_id="BAI29167.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   HLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNEKQNIAAA
FT                   VASMIGLGIGLTPSADDYLTGLALILFIPGHPSEKYKEEFYLGMQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     gtgtgggcgc taactgcgga tgcggatttt ctggcgcagc gggggcaagg acaggttgaa        60
     caggtctttg ccagagcggt aaatatcgca ctcccggctc gccagcagtt gctgacgctg       120
     ctttgtgaag agtacgacaa tgcgccaaac agttgtcggt tggcactcac tcactttgat       180
     gatctgttcc ggcatggtga taaggttcag tttgacgatc aaggtattac ggttggtcaa       240
     catcttcata tagagatgag tcgttgtcgg cgttggctgt ccccaacctt gcaaatgacc       300
     gctgtgaatt ttcaccttat cgcctggcaa cagtggcacg acattattca tcagcacctg       360
     ggggaaaatg aaaccctgtt taattatcgc ggcgataatc cgttttatca ggcgttaaat       420
     aaagaactac atattaaacg acgggcagtt attcaggcag taaacgaaaa acaaaatatc       480
     gccgcagcgg tcgccagtat gattgggtta gggattggcc ttacgccatc agccgacgat       540
     tatttaacag gtctggcgct tattttattt attcccgggc atccgtcgga aaaatacaaa       600
     gaggaatttt atctcggtat gcagcgcggc agaaataaca ccacattatt aagtgctata       660
     acgctggaag ccgcattaca acaacgttgc cgggaaaata ttcatcgttt tattcacaac       720
     attatttatg acatccctgg gaacgcaact caggcaatag aaaaaattaa acatattggc       780
     tccagttccg gctgcgacat gctgtatggc atggccgatg gttgtgcgct gagccaaacc       840
     tacggaggga attatgtcag ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page