(data stored in ACNUC10821 zone)

EMBL: AP010958.YAHF

AP010958.YAHF        Location/Qualifiers
FT   CDS_pept        340766..342313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECO103_0298"
FT                   /product="predicted acyl-CoA synthetase"
FT                   /note="contains NAD(P)-binding domain and succinyl-CoA
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29168"
FT                   /db_xref="GOA:C8U210"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:C8U210"
FT                   /protein_id="BAI29168.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKAGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIVLISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRGETPVDEQGLQFARGSKEAALKAVMLSGVKQEHLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHGDVYSNIQPDPEFRLQDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     atgtcagtta aaatagtcat taaaccgaat acctattttg attctgtctc gctgatgtct        60
     atctccacgc gtgcaaataa actcgacggc gtcgagcagg catttgtggc gatggcgacc       120
     gaaatgaaca aaggtgtact gaaaaattta ggactgctga cgccggagct ggaacaggcg       180
     aaaaacggcg acctgatgat tgtcatcaac ggcaaagcgg gcgcggacaa cgaacagttg       240
     ctggtggaga ttgaagaact gttcaacacc aaagcgcaaa gcggctcgca tgaggcgcgt       300
     tacgccacta ttgccagcgc caaaaagcat atcccggaaa gtaacctggc ggtgatttcg       360
     gtcaacggtc tgtttgccgc tcgcgaagcg cgtcaggcgc tgcaaaacga tctcaacgtg       420
     atgctgtttt ccgataacgt ctcagttgaa gatgaattgg cgctcaagca actggcccac       480
     gaaaaagggc tgctgatgat ggggccagac tgtggcacgg cgattattaa cggcgcggcg       540
     ctctgttttg gtaacgccgt gcgtcgcggc aacatcggta ttgttggcgc atccggcacc       600
     ggcagccagg agctgagcgt ccgcattcat gaatttggcg gcggcgtttc gcaactgatt       660
     ggcaccggcg ggcgcgacct gagcgagaaa atcggcggcc tgatgatgct cgacgccatc       720
     ggcatgctgg aaaacgatcc gcaaactgaa atcattgtgc ttatctccaa accgcccgcg       780
     cctgcggtgg cccgcaaagt gctggaacgc gcgcgcgcct gccgcaagcc ggtggtggtc       840
     tgtttcctcg gtcgtggcga aacgccagtg gatgagcagg ggctacagtt tgcccgcggc       900
     agcaaagagg cggcattgaa agcggtgatg ctctccggcg tgaaacagga acatctcgac       960
     ctgcatacgc tgaaccagcc gttgattgct gacgtacgtg ctcgcctgca accgcagcag      1020
     aagtacattc gtggcctgtt ctgtggcggc acgctgtgtg acgaaaccat gttcgcggtg      1080
     atggaaaaac acggcgatgt ctacagcaac attcagcccg atccggaatt ccgcctgcaa      1140
     gatatcaacc gtagcatcaa acacaccttc ctcgactttg gcgatgacga cttcaccaac      1200
     ggcaagccgc atccaatgat tgaccccacc aaccgcatca gtcgcttgat cgaagaggcg      1260
     cgcgatccag aagtggcggt gatcgtgatg gattttgtgc tcggatttgg atcgcatgaa      1320
     gatccggtcg gctccaccat cgaggcgatc aaagaagcga aagcgatcgc cgccgccgaa      1380
     ggacgcgagt tgatcattct cgcctatgtg ctgggcaccg atctcgatac gccatcatta      1440
     gaacaacaaa gccagatgct gcttgatgcc ggagtgattc tggcgagcag cagcaccaat      1500
     accggattgc tggcgcgtga atttatctgc aaaggggagg aagcctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page