(data stored in ACNUC10821 zone)

EMBL: AP010958.YAIL

AP010958.YAIL        Location/Qualifiers
FT   CDS_pept        385821..386360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECO103_0336"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29205"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:C8U247"
FT                   /protein_id="BAI29205.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     atggcaaaac ttaccttaca agagcagttg ctcaaagcag gattagtcac cagcaaaaaa        60
     gcggcgaagg tcgagagaac ggcgaaaaaa tcgcgcgttc aggcgcgtga agctcgggcg       120
     gcggtagaag aaaataaaaa ggcacagctt gagcgtgata aacagcttag cgaacagcaa       180
     aaacaagcgg cgttggcgaa agaatataaa gcccaggtga agcagcttat tgaaatgaac       240
     cgaatcacca ttgccaatgg tgatattggt tttaacttca ctgacggcaa tctgattaag       300
     aagatttttg tcgataagct cacacaggcg cagttgatta atggtcgtct ggcgattgcc       360
     cgcttgttgg tcgataacaa tagcgaaggt gaatacgcca ttattcccgc cagcgttgcc       420
     gataaaattg ctcagcgtga tgccagcagt attgtgttgc acagcgcgct cagtgccgaa       480
     gagcaggatg aagacgaccc atatgccgac ttcaaagtgc ctgatgattt gatgtggtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page