(data stored in ACNUC10821 zone)

EMBL: AP010958.YAIZ

AP010958.YAIZ        Location/Qualifiers
FT   CDS_pept        406013..406225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECO103_0355"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29224"
FT                   /db_xref="GOA:C8U266"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:C8U266"
FT                   /protein_id="BAI29224.1"
FT                   /translation="MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGL
FT                   VTWVISFWLAGLIIRRRDEETENAQ"
     atgaatctgc ctgtaaaaat ccgccgtgac tggcactact atgcgttcgc cattggcctt        60
     atattcattc ttaatggcgt ggtggggtta ctgggatttg aagcaaaagg ttggcagacc       120
     tatgccgtcg gtctggtgac gtgggtgatt agtttctggc tggcggggtt gattattcgt       180
     cgtcgcgatg aagaaactga aaacgcccaa taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page