(data stored in ACNUC10821 zone)

EMBL: AP010958.YAJC

AP010958.YAJC        Location/Qualifiers
FT   CDS_pept        433603..433935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ECO103_0381"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29249"
FT                   /db_xref="GOA:C8U291"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C8U291"
FT                   /protein_id="BAI29249.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
     atgagctttt ttatttctga tgcggtagcg gcaacgggtg caccggcgca aggtagcccg        60
     atgtctttga ttttgatgct ggtggtattc ggtctgattt tctatttcat gatcctgcgt       120
     ccacagcaga agcgcaccaa agaacacaaa aagctgatgg actccattgc caaaggtgat       180
     gaagttctga cgaacggtgg cctggttggc cgcgtaacca aagtagcgga aaacggctac       240
     attgctatcg cgctgaatga caccactgaa gtagttatta aacgtgactt cgtagctgcc       300
     gtcctgccga aaggcaccat gaaggcgctg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page