(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAA

AP010958.YBAA        Location/Qualifiers
FT   CDS_pept        485261..485614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECO103_0432"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29300"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2E2"
FT                   /protein_id="BAI29300.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAATQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     atgaagtatg ttgatggttt tgtggttgcc gttcctgccg ataaaaagga tgcctatcgg        60
     gaaatggccg ctaaggctgc gccattgttt aaagagtttg gcgcgcttcg tattgtcgaa       120
     tgctgggcca gcgatgtacc ggatggcaaa gtgaccgatt ttcgtatggc ggtgaaagcg       180
     gaagagaatg aagaggttgt ctttagctgg attgaatacc cttcaaaaga ggtccgcgac       240
     gctgctactc aaaagatgat gtcggaccca cggatgaaag agttcggcga gtccatgccg       300
     tttgacggca agcgaatgat ctatggcgga ttcgagtcaa tcatcgacga atag             354
//

If you have problems or comments...

PBIL Back to PBIL home page