(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAD

AP010958.YBAD        Location/Qualifiers
FT   CDS_pept        439318..439767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="ECO103_0387"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29255"
FT                   /db_xref="GOA:C8U297"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:C8U297"
FT                   /protein_id="BAI29255.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
     atgcattgcc cattctgttt cgccgtggac actaaggtaa ttgactctcg tctcgtgggc        60
     gagggttcat ccgtacgccg ccgtcggcag tgtctggtgt gtaatgaacg tttcaccacc       120
     tttgaagtgg cggagctggt tatgccgcgt gttgtaaaaa gcaacgacgt gcgtgaaccg       180
     tttaatgaag agaaattgcg cagcggaatg ctgcgggcgc tggaaaaacg tccggtgagt       240
     tccgatgacg ttgaaatggc aatcaatcat attaaatcgc agttgcgcgc caccggtgag       300
     cgcgaagtac cgagcaagat gattggcaat ctggtgatgg agcaattgaa aaagctcgat       360
     aaagtcgcct atatccgttt tgcctctgtc taccgcagtt tcgaagatat caaagaattt       420
     ggcgaagaga tcgcgcgcct ggaggactaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page