(data stored in SCRATCH zone)

EMBL: AP010958.YBAV

AP010958.YBAV        Location/Qualifiers
FT   CDS_pept        472526..472897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECO103_0419"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29287"
FT                   /db_xref="GOA:C8U2C9"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2C9"
FT                   /protein_id="BAI29287.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTTVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     atgaaacacg gaattaaagc actgctcatt accctgtccc tggcctgtgc cggaatgtct        60
     catagcgcgc tggcggcagc ttctgtggcg aaaccgacaa cggtagaaac caaagcggaa       120
     gctcctgcag cacaaagtaa agcagcagta ccggcgaaag ccagtgacga agaaggcacc       180
     cgggtcagca ttaataatgc cagcgcggaa gagctagccc gcgcgatgaa tggcgttggc       240
     ctgaagaaag cgcaggcgat tgtcagttat cgcgaagagt acggtccgtt taaaacggtg       300
     gaggatctaa agcaggtgcc ggggatgggc aattcgctgg tggaacgtaa tctggcggta       360
     ttaaccctgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page