(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAX

AP010958.YBAX        Location/Qualifiers
FT   CDS_pept        complement(473441..474136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="ECO103_0421"
FT                   /product="predicted aluminum resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29289"
FT                   /db_xref="GOA:C8U2D1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2D1"
FT                   /protein_id="BAI29289.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLR"
     atgaaacgtg ctgtcgttgt gttcagtgga ggccaggatt ccaccacctg tctggtgcag        60
     gcattacaac aatatgatga agtccattgc gtgacgttcg attacggtca gcgacatcgc       120
     gcagaaatcg acgtggcacg cgaactggcg ctgaaactgg gagcacgcgc gcataaggtt       180
     cttgatgtaa cgctgctcaa cgagctggcg gtcagcagcc tgacacgtga cagcattccg       240
     gtgcctgatt atgaacctga agccgatggc atcccgaata cgtttgtccc tgggcgtaat       300
     attttgttcc tgacgctggc ggcaatatat gcgtatcagg taaaagcaga agccgtaatt       360
     accggcgtct gtgaaacgga tttctccggc tacccggatt gccgcgatga gtttgtgaaa       420
     gcactaaacc atgccgtcag tttgggcatg gcgaaagata ttcgttttga aacgccgctg       480
     atgtggattg ataaagcgga aacctgggcg ctggcagatt attacggcaa actggattta       540
     gtccgtaacg aaacgttgac ctgctataac ggcattaaag gcgacggttg cggtcattgt       600
     gcggcatgta atttacgcgc caacggtttg aatcattatc tggccgataa accgacggtg       660
     atggcagcga tgaagcagaa aaccgggttg aggtaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page