(data stored in ACNUC10821 zone)

EMBL: AP010958.YBBA

AP010958.YBBA        Location/Qualifiers
FT   CDS_pept        528221..528907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="ECO103_0471"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29339"
FT                   /db_xref="GOA:C8U2I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2I1"
FT                   /protein_id="BAI29339.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLGHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
     atgccagcgg aaaacattgt tgaagttcat catcttaaga agtccgtcgg tcagggggag        60
     catgaactct ccatcctcac cggagttgag ctggttgtca aacgtggcga gaccatcgca       120
     ctggtgggcg agtcgggatc gggtaagtca accttgctgg cgatcctcgc cgggcttgat       180
     gacggcagca gtggcgaagt gagtctggtg ggacaaccgc tacataatat ggacgaagaa       240
     gcgcgggcaa agttgcgcgc gaagcacgtc ggctttgttt ttcagtcatt tatgttaatt       300
     cctaccctta acgcgctgga aaacgtcgag cttccggctc tgctgcgcgg tgagagtagc       360
     gcggaaagtc gtaacggggc gaaagcgttg ctcgaacagt tagggctggg taaacgtctg       420
     ggtcatcttc cggcacagct ttccggcggt gaacagcaac gagtggcgct ggcacgagcc       480
     tttaatggtc gacctgatgt gctgtttgcc gacgaaccca ccggcaacct tgaccgccag       540
     acgggcgata aaattgccga cctgctgttt tccctcaacc gtgaacatgg caccacgttg       600
     attatggtga cccacgacct gcaactggcg gcacgctgcg accgctgctt acggctggtg       660
     aacgggcagt tgcaggagga agcatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page